Recombinant Full Length Aromatoleum Aromaticum Macrolide Export Atp-Binding/Permease Protein Macb(Macb) Protein, His-Tagged
Cat.No. : | RFL31867AF |
Product Overview : | Recombinant Full Length Aromatoleum aromaticum Macrolide export ATP-binding/permease protein MacB(macB) Protein (Q5P6D5) (1-641aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Aromatoleum aromaticum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-641) |
Form : | Lyophilized powder |
AA Sequence : | MPLIELSGVTKTFRNGELAVEVLHGIDLTILPGEFVAIVGSSGSGKSTLMNILGCLDRPT SGSYRFMGRNVAAFDRDELALLRRETFGFVFQSYHLIGGASARENVEVPAVYSGMPPAER HARATGLLASLGLGERIEHRPNQLSGGQQQRVSIARALMNGGRVILADEPTGALDTKSGA EVMQLLNKLSADGHTIILITHEREVAEQAQRIIEIRDGRIVADPGPRPRSGLEPDFAPHV DRTSPLSDIVEAARTALRALRANIFRAALTLLGIVIGVAAVIAMLAIGDGAKQDVVDRIS SMGTNLLTVRPGAPNQRGRDTTATLVLDDVRAIRDLPNVLAAVPEQSSTVTIRSGNADHR TSANATGADFTLARAWPIARGTFFGAADERSYATVAVLGQTVAKALFGDADPVGEFVLVN SIMFQVLGVMGPQGATPWGTDQDDVIFVPYSTGSLRLFGQRHLRNATIAVEDVAAIDDTQ AAVHELLQARHGGIEDFQIRNMASVIESVSETQNTLTVLLGTVAAISLLVGGIGVMNIML VSVTERTREIGIRMATGARMKNILQQFLIEALVVSALGGVIGVVVGLGAAAIIEAFDTPI VYSAPPVLLAFGCAFATGLVFGYLPARKAARLDPVVALASE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB |
Synonyms | macB; AZOSEA10010; ebA1848; Macrolide export ATP-binding/permease protein MacB |
UniProt ID | Q5P6D5 |
◆ Recombinant Proteins | ||
Dkk4-2391M | Recombinant Mouse Dkk4 Protein, His (Fc)-Avi-tagged | +Inquiry |
BMR-0369B | Recombinant Bacillus subtilis BMR protein, His-tagged | +Inquiry |
ERBB2-41HA | Recombinant Human ERBB2 protein, Fc-tagged, APC labeled | +Inquiry |
FAM18A-1452H | Recombinant Human FAM18A | +Inquiry |
FLI1-7818H | Recombinant Human FLI1 protein, His & T7-tagged | +Inquiry |
◆ Native Proteins | ||
DIS-2019 | Active Alpha-Cyclomaltodextrin glucanotransferase | +Inquiry |
Ighg2b-162M | Native Mouse Immunoglobulin G2b | +Inquiry |
ITGA2B-10H | Native Human GPIIbIIIa | +Inquiry |
CA72-4-160H | Native Human Cancer Antigen 72-4 | +Inquiry |
Bone Marrow-007H | Human Bone Marrow Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ST6GAL2-1703HCL | Recombinant Human ST6GAL2 cell lysate | +Inquiry |
CCDC87-7744HCL | Recombinant Human CCDC87 293 Cell Lysate | +Inquiry |
KCNH1-5060HCL | Recombinant Human KCNH1 293 Cell Lysate | +Inquiry |
CNOT2-7403HCL | Recombinant Human CNOT2 293 Cell Lysate | +Inquiry |
KIAA1279-001HCL | Recombinant Human KIAA1279 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All macB Products
Required fields are marked with *
My Review for All macB Products
Required fields are marked with *
0
Inquiry Basket