Recombinant Full Length Nitrobacter Winogradskyi Macrolide Export Atp-Binding/Permease Protein Macb(Macb) Protein, His-Tagged
Cat.No. : | RFL31402NF |
Product Overview : | Recombinant Full Length Nitrobacter winogradskyi Macrolide export ATP-binding/permease protein MacB(macB) Protein (Q3SQZ1) (1-645aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Nitrobacter winogradskyi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-645) |
Form : | Lyophilized powder |
AA Sequence : | MTPPLIELEGIRRSYRSGDVVTHALRGVGLSIHAGEFVAIIGASGSGKSTLMNIIGLMDR PSDGAYRFGGRDVATLNRDELAALRRGCFGFIFQNYHLIPTVSALGNVEMPAIHAGAPRA YRHRRATALLTRLGLANRITNRPSQLSGGQQQRVSIARALMNGGAVILADEPTGALDSKS GTEVLGILKKLAGDGHTVILITHDSKVAAAAERIIRIEDGLIVSDSGPDPEKVSSSIAVV PWQASDSSPPLWTWLEEAARSAFAALAINPVRTALTLSGIVIGVASVVAMMAIGRGAQAS YIERASAIGTNWIVVDRAGESTGNSLPLTPADAQAIKDMDNVSGSMPAMWDMATMRRGNI DLNTDVVATTAEFRTVHNWDMAKGTFFTKQDEVSGGPVVLLGATLASKLFPGIADPSGSN ILINNLPFLVTGVLESKGLSERGTDRDKRAVMPLRTATMRLFGKDDLSEIVVSIADMSRL HETKEAIKALLIRRHGREDFYIYDSASAFQKAEDERRSSNLLLSAIAAISMLVGGIGIMN IMLITVSERTREIGVRTAIGARTADILGQFLTEAVVLAAIGGVVGLLLGAVIGVGAALLF GMTVIFSVTMALGALMGAVVMGTVFGFMPAYRAARLKPIEALARG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB |
Synonyms | macB; Nwi_2041; Macrolide export ATP-binding/permease protein MacB |
UniProt ID | Q3SQZ1 |
◆ Recombinant Proteins | ||
GNE-2260R | Recombinant Rat GNE Protein, His (Fc)-Avi-tagged | +Inquiry |
FRMD7-3362M | Recombinant Mouse FRMD7 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATXN7L1-10071H | Recombinant Human ATXN7L1, His-tagged | +Inquiry |
PLEKHG2-2747H | Recombinant Human PLEKHG2 protein, His-tagged | +Inquiry |
PVRIG-230C | Active Recombinant Cynomolgus PVRIG protein, Fc-tagged | +Inquiry |
◆ Native Proteins | ||
PerCP-02D | Native Dinophyceae sp. PerCP Protein | +Inquiry |
Complement C4a-52H | Native Human Complement C4a | +Inquiry |
CPA-01B | Native Bovine Pancreas Carboxypeptidase A, Type II-PMSF treated | +Inquiry |
Testosterone-01H | Native Human Testosterone | +Inquiry |
F13A1-1881H | Native Human Coagulation Factor XIII, A1 Polypeptide | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAW 264.7-176H | RAW 264.7 Whole Cell Lysate | +Inquiry |
TFDP2-1131HCL | Recombinant Human TFDP2 293 Cell Lysate | +Inquiry |
SIGIRR-1091HCL | Recombinant Human SIGIRR cell lysate | +Inquiry |
HOXC10-5419HCL | Recombinant Human HOXC10 293 Cell Lysate | +Inquiry |
ZNF473-2033HCL | Recombinant Human ZNF473 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All macB Products
Required fields are marked with *
My Review for All macB Products
Required fields are marked with *
0
Inquiry Basket