Recombinant Full Length Rat T-Cell Immunomodulatory Protein(Itfg1) Protein, His-Tagged
Cat.No. : | RFL34344RF |
Product Overview : | Recombinant Full Length Rat T-cell immunomodulatory protein(Itfg1) Protein (Q8R4E1) (33-610aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (33-610) |
Form : | Lyophilized powder |
AA Sequence : | LHNVTAELFGGEAWGTLAAFGDLNSDKQTDLFVLRERNDLIVFLADQSAPYFKPKVKVSL KNFSALVTSVVPGDYDGDSQMDVLLTYFPQNHSNNELGAVIFWGQNQTLDPKNMTILNRT FHDQPLIMDFNGDLIPDVFAITNESSQPQILLGGDLSWHPALTTKSKMRDPHSRAFIDLT EDFTADLFLTTLSASNTFQFEIWENLGGNFSIRSVFEKPKNLVVVGQSAFADFDGDGHMD HLLPGCEDKDCQKSAIYLMRSGTGQWAPVLQDSSNKGTLWGFVPFVHEERPTAIPVPLTL HIGDYNMDGYPDALAILKNTSGSNQQAFLLENVPCNNASCEEVHRMFKVYWDLAGLNLIK DAMVATFFDIYEDGTLDIIVLSKGYTKSDVAIHTLKNNFEADAYFVKVIVLSGLCSSDCP RKITPFGVNQPGPYIMYTTVDANGYLKNGSAGQLSQSAHLALQLPYNVLGLGRSANFLDH LFVGIPRPSGEKSIRKQEWTAIIPNSQLMVIPYPHSVPRSWSAKLYLTPSNIVLLTAVAL TGVCVFILAIIAILHWQEKKADDREKRQEAHRFHFDAM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Itfg1 |
Synonyms | Itfg1; Cda08; Lnkn-1; Tip; T-cell immunomodulatory protein; Protein TIP; CDA08-like protein; Integrin-alpha FG-GAP repeat-containing protein 1; Linkin |
UniProt ID | Q8R4E1 |
◆ Recombinant Proteins | ||
PC-4290R | Recombinant Rat PC Protein | +Inquiry |
NRK-2798C | Recombinant Chicken NRK | +Inquiry |
SAP063A-022-2585S | Recombinant Staphylococcus aureus (strain: EMRSA-2, other: HA-MRSA) SAP063A_022 protein, His-tagged | +Inquiry |
DCPS-27368TH | Recombinant Human DCPS, His-tagged | +Inquiry |
ASPHD2-798M | Recombinant Mouse ASPHD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
GG-192M | Native Mouse Gamma Globulin protein | +Inquiry |
APOC1-27330TH | Native Human APOC1 | +Inquiry |
ACTA1-157R | Native Rabbit skeletal muscle alpha Actin | +Inquiry |
SHBG-30637TH | Native Human SHBG protein | +Inquiry |
Fva-285B | Active Native Bovine Factor Va | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACVR1B-2130HCL | Recombinant Human ACVR1B cell lysate | +Inquiry |
STAT5B-1709HCL | Recombinant Human STAT5B cell lysate | +Inquiry |
ZCCHC10-1961HCL | Recombinant Human ZCCHC10 cell lysate | +Inquiry |
PANC-1-059HCL | Human PANC-1 Whole Cell Lysate | +Inquiry |
Colon-135R | Rat Colon Tissue Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Itfg1 Products
Required fields are marked with *
My Review for All Itfg1 Products
Required fields are marked with *
0
Inquiry Basket