Recombinant Full Length Human T-Cell Immunomodulatory Protein(Itfg1) Protein, His-Tagged
Cat.No. : | RFL29694HF |
Product Overview : | Recombinant Full Length Human T-cell immunomodulatory protein(ITFG1) Protein (Q8TB96) (34-612aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (34-612) |
Form : | Lyophilized powder |
AA Sequence : | LHNVTAELFGAEAWGTLAAFGDLNSDKQTDLFVLRERNDLIVFLADQNAPYFKPKVKVSF KNHSALITSVVPGDYDGDSQMDVLLTYLPKNYAKSELGAVIFWGQNQTLDPNNMTILNRT FQDEPLIMDFNGDLIPDIFGITNESNQPQILLGGNLSWHPALTTTSKMRIPHSHAFIDLT EDFTADLFLTTLNATTSTFQFEIWENLDGNFSVSTILEKPQNMMVVGQSAFADFDGDGHM DHLLPGCEDKNCQKSTIYLVRSGMKQWVPVLQDFSNKGTLWGFVPFVDEQQPTEIPIPIT LHIGDYNMDGYPDALVILKNTSGSNQQAFLLENVPCNNASCEEARRMFKVYWELTDLNQI KDAMVATFFDIYEDGILDIVVLSKGYTKNDFAIHTLKNNFEADAYFVKVIVLSGLCSNDC PRKITPFGVNQPGPYIMYTTVDANGYLKNGSAGQLSQSAHLALQLPYNVLGLGRSANFLD HLYVGIPRPSGEKSIRKQEWTAIIPNSQLIVIPYPHNVPRSWSAKLYLTPSNIVLLTAIA LIGVCVFILAIIGILHWQEKKADDREKRQEAHRFHFDAM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ITFG1 |
Synonyms | ITFG1; LNKN-1; TIP; CDA08; T-cell immunomodulatory protein; Protein TIP; Integrin-alpha FG-GAP repeat-containing protein 1; Linkin |
UniProt ID | Q8TB96 |
◆ Recombinant Proteins | ||
tcdB-007C | Recombinant C. difficile tcdB Protein | +Inquiry |
PPARA-318H | Recombinant Human PPARA protein, His/MBP-tagged | +Inquiry |
FABHB-0740B | Recombinant Bacillus subtilis FABHB protein, His-tagged | +Inquiry |
GPX4-21H | Recombinant Human GPX4 Protein, 170 residues | +Inquiry |
RFL25712VF | Recombinant Full Length Vibrio Vulnificus Disulfide Bond Formation Protein B(Dsbb) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
LDL-399H | Native Human Low Density Lipoprotein, Oxidized | +Inquiry |
C5b6-1537H | Active Native Human C5b,6 Complex Protein | +Inquiry |
Collagen-56B | Native Bovine Collagen Type II | +Inquiry |
CA-50-381H | Active Native Human Cancer Antigen 50 | +Inquiry |
OX-LDL-985H | Native Human Lipoproteins, Oxidized LDL protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
POLR3G-1393HCL | Recombinant Human POLR3G cell lysate | +Inquiry |
STK33-1401HCL | Recombinant Human STK33 293 Cell Lysate | +Inquiry |
HINFP-5559HCL | Recombinant Human HINFP 293 Cell Lysate | +Inquiry |
INPP5F-863HCL | Recombinant Human INPP5F cell lysate | +Inquiry |
PARL-3431HCL | Recombinant Human PARL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ITFG1 Products
Required fields are marked with *
My Review for All ITFG1 Products
Required fields are marked with *
0
Inquiry Basket