Recombinant Full Length Mouse T-Cell Immunomodulatory Protein(Itfg1) Protein, His-Tagged
Cat.No. : | RFL6228MF |
Product Overview : | Recombinant Full Length Mouse T-cell immunomodulatory protein(Itfg1) Protein (Q99KW9) (33-610aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (33-610) |
Form : | Lyophilized powder |
AA Sequence : | LHNVTAELFGAEAWGTLAAFGDLNSDKQTDLFVLRERNDLIVFLADQSAPYFKPKVKVSL KTLSALVTSVVPGDYDGDSQMDVLLTYFPQNHTNSELGAVIFWGQNQTLDPKNMTILNRT FHDQPLIMDFNGDLIPDVFGITNESSQPQILLGGDLSWHPALTTKSKMRDPHSHAFIDLT EDFTADLFLTTLTASNAFQFEIWENLGGNFSIHSVFEKPKNLVVVGQSAFADFDGDGHMD HLLPGCEDKDCQKSAIYLMRSGTGQWVPVLQDFSNKGTLWGFVPFVHEEQPTTIPIPLTL HIGDYNMDGYPDALAILKNTSGSNQQAFLLENVPCNNASCEEVHRMFKVYWDLAGLNLIK DAIVATFFDIYEDGILDIIVLSKGYTKNDVAIHTLKNNFEADAYFVKVIVLSGLCSNDCP RKITPFGVNQPGPYIMYTTVDANGYLKNGSAGQLSQSAHLALQLPYNVLGLGRSANFLDH LFVGIPRPSGEKSIRKQEWTAIIPNSQLIVIPYPHNVPRSWSAKLYLTPSNIVLLTAVAL IGVCIFILAIIAILHWQEKKADDREKRQEAHRFHFDAM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Itfg1 |
Synonyms | Itfg1; D8Wsu49e; Lnkn-1; Tip; T-cell immunomodulatory protein; Protein TIP; Integrin-alpha FG-GAP repeat-containing protein 1; Linkin |
UniProt ID | Q99KW9 |
◆ Recombinant Proteins | ||
Vgf-6919M | Recombinant Mouse Vgf Protein, Myc/DDK-tagged | +Inquiry |
Tag-002 | Recombinant Tags | +Inquiry |
LYPD4-4553H | Recombinant Human LYPD4 Protein, GST-tagged | +Inquiry |
CDC26-27901TH | Recombinant Human CDC26, His-tagged | +Inquiry |
BRCA1-5743C | Recombinant Chicken BRCA1 | +Inquiry |
◆ Native Proteins | ||
Serpinc1-298M | Active Native Mouse Antithrombin III | +Inquiry |
PLG-30879TH | Native Human PLG | +Inquiry |
AGP-001B | Native Bovine AGP Protein | +Inquiry |
AMBP-5312H | Native Human Alpha-1-Microglobulin/Bikunin Precursor | +Inquiry |
KNG1-29338TH | Native Human KNG1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP2R3C-2920HCL | Recombinant Human PPP2R3C 293 Cell Lysate | +Inquiry |
BOLA1-173HCL | Recombinant Human BOLA1 cell lysate | +Inquiry |
RD3-2441HCL | Recombinant Human RD3 293 Cell Lysate | +Inquiry |
PITX2-3165HCL | Recombinant Human PITX2 293 Cell Lysate | +Inquiry |
DUSP14-6781HCL | Recombinant Human DUSP14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Itfg1 Products
Required fields are marked with *
My Review for All Itfg1 Products
Required fields are marked with *
0
Inquiry Basket