Recombinant Full Length Rat Regulator Of Microtubule Dynamics Protein 3(Fam82A2) Protein, His-Tagged
Cat.No. : | RFL7051RF |
Product Overview : | Recombinant Full Length Rat Regulator of microtubule dynamics protein 3(Fam82a2) Protein (Q66H15) (1-471aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-471) |
Form : | Lyophilized powder |
AA Sequence : | MSRLGALGGSRAGLGLLLGTAAGLGFLCVLYSQRWKRTQRHGRSQSLPNSLDYAQTSERG RQVTQLRAIPGEAGDAAMLSSLPQEGQEKVLDRLDFVLTSLMALRREVEELQRSLQGLAG EIVGEVRSHMEENQRVARRRRFPFARERSDSTGSSSVYFTASSGATLTDAESEGGYTTAN AESDYERDSDKESEDAEDEVSCETVKMGRKDSLDLDMEVASSPASAALEDDDSSGLEDVQ LLLQQADELHQGSEQNKQEGFQLLLNNKLAYGSRQDFLWRLARAYSDMTELTEEESEKKS YALNGKEEAEAALKKGDESAASHLWYAVLCGQLAEHEGISKRIQSGFSFKEHVDKAIELQ PEDPRGHFLLGRWCYQVSHLSWLEKKTATALFESPLSATVQDALQSFLKAEELQPGFSKA GRVYISKCYRELGKNSEARKWLNLAQELPNITNEDSAFQKDLEELEVILGK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Rmdn3 |
Synonyms | Rmdn3; Fam82a2; Fam82c; Regulator of microtubule dynamics protein 3; RMD-3; Protein FAM82A2; Protein FAM82C |
UniProt ID | Q66H15 |
◆ Recombinant Proteins | ||
SERPINA1-1841H | Recombinant Human SERPINA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MAP4K2-28743TH | Recombinant Human MAP4K2 | +Inquiry |
SPRR2E-5310H | Recombinant Human SPRR2E Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Rara-5687R | Recombinant Rat Rara protein, His & T7-tagged | +Inquiry |
Was-6962M | Recombinant Mouse Was Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Neuraminidase-012C | Active Native Clostridium perfringens Phospholipase C, Type I | +Inquiry |
PRC1-5267P | Active Native Yeast PRC1 Protein | +Inquiry |
CTSH-27404TH | Native Human CTSH | +Inquiry |
Protein S-90H | Native Human Protein S | +Inquiry |
IGHD -20H | Native Human IgD | +Inquiry |
◆ Cell & Tissue Lysates | ||
LMAN1-4719HCL | Recombinant Human LMAN1 293 Cell Lysate | +Inquiry |
SRPK3-566HCL | Recombinant Human SRPK3 cell lysate | +Inquiry |
CCDC138-644HCL | Recombinant Human CCDC138 cell lysate | +Inquiry |
TPST2-832HCL | Recombinant Human TPST2 293 Cell Lysate | +Inquiry |
THYN1-1081HCL | Recombinant Human THYN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Rmdn3 Products
Required fields are marked with *
My Review for All Rmdn3 Products
Required fields are marked with *
0
Inquiry Basket