Recombinant Human SPRR2E Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SPRR2E-5310H
• Product Overview: SPRR2E MS Standard C13 and N15-labeled recombinant protein (NP_001019380) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a member of a family of small proline-rich proteins clustered in the epidermal differentiation complex on chromosome 1q21. The encoded protein, along with other family members, is a component of the cornified cell envelope that forms beneath the plasma membrane in terminally differentiated stratified squamous epithelia. This envelope serves as a barrier against extracellular and environmental factors. The seven SPRR2 genes (A-G) appear to have been homogenized by gene conversion compared to others in the cluster that exhibit greater differences in protein structure.
• Molecular Mass: 7.7 kDa
• AA Sequence: MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKCPPVTPSPPCQPKCPPKSKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SPRR2E small proline rich protein 2E [ Homo sapiens (human) ]
• Official Symbol: SPRR2E
• Synonyms: SPRR2E; small proline rich protein 2E; small proline-rich protein 2E; SPR-2E; SPR-II; small proline-rich protein II
• Gene ID: 6704
• mRNA Refseq: NM_001024209
• Protein Refseq: NP_001019380
• MIM: 617588
• UniProt ID: P22531