Recombinant Full Length Rat Potassium Voltage-Gated Channel Subfamily D Member 2(Kcnd2) Protein, His-Tagged
Cat.No. : | RFL29035RF |
Product Overview : | Recombinant Full Length Rat Potassium voltage-gated channel subfamily D member 2(Kcnd2) Protein (Q63881) (1-630aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-630) |
Form : | Lyophilized powder |
AA Sequence : | MAAGVAAWLPFARAAAIGWMPVASGPMPAPPRQERKRTQDALIVLNVSGTRFQTWQDTLE RYPDTLLGSSERDFFYHPETQQYFFDRDPDIFRHILNFYRTGKLHYPRHECISAYDEELA FFGLIPEIIGDCCYEEYKDRRRENAERLQDDADTDNTGESALPTMTARQRVWRAFENPHT STMALVFYYVTGFFIAVSVIANVVETVPCGSSPGHIKELPCGERYAVAFFCLDTACVMIF TVEYLLRLAAAPSRYRFVRSVMSIIDVVAILPYYIGLVMTDNEDVSGAFVTLRVFRVFRI FKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPAA FWYTIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRAD KRRAQKKARLARIRAAKSGSANAYMQSKRNGLLSNQLQSSEDEPAFVSKSGSSFETQHHH LLHCLEKTTNHEFVDEQVFEESCMEVATVNRPSSHSPSLSSQQGVTSTCCSRRHKKSFRI PNANVSGSHRGSVQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISI PTPPVTTPEGDDRPESPEYSGGNIVRVSAL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Kcnd2 |
Synonyms | Kcnd2; Potassium voltage-gated channel subfamily D member 2; RK5; Shal1; Voltage-gated potassium channel subunit Kv4.2 |
UniProt ID | Q63881 |
◆ Recombinant Proteins | ||
BTG3-2533M | Recombinant Mouse BTG3 Protein | +Inquiry |
VTCN1-2914M | Recombinant Mouse VTCN1 protein, His-tagged | +Inquiry |
CARD16-1690H | Recombinant Human CARD16 Protein, GST-tagged | +Inquiry |
Ctla4-1144RAF647 | Recombinant Rat Ctla4 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
Tat-6297M | Recombinant Mouse Tat Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
KLKB1-27924TH | Native Human KLKB1 | +Inquiry |
Ferritin-181R | Native Rat Ferritin | +Inquiry |
SERPINC1-5487R | Native Rabbit Serpin Peptidase Inhibitor, Clade C (antithrombin), Member 1 | +Inquiry |
COL2A1-1648H | Native Human COL2A1 Protein | +Inquiry |
FTH1-001H | Native Horse FTH1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
VKORC1-405HCL | Recombinant Human VKORC1 293 Cell Lysate | +Inquiry |
FKBP4-6205HCL | Recombinant Human FKBP4 293 Cell Lysate | +Inquiry |
Postcentral Gyrus-398C | Cynomolgus monkey Postcentral Gyrus Lysate | +Inquiry |
CD300LG-957RCL | Recombinant Rat CD300LG cell lysate | +Inquiry |
MRPL43-4164HCL | Recombinant Human MRPL43 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Kcnd2 Products
Required fields are marked with *
My Review for All Kcnd2 Products
Required fields are marked with *
0
Inquiry Basket