Recombinant Full Length Mustela Putorius Furo Potassium Voltage-Gated Channel Subfamily D Member 2(Kcnd2) Protein, His-Tagged
Cat.No. : | RFL9739MF |
Product Overview : | Recombinant Full Length Mustela putorius furo Potassium voltage-gated channel subfamily D member 2(KCND2) Protein (Q8HYZ1) (1-630aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mustela putorius furo (European domestic ferret) (Mustela furo) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-630) |
Form : | Lyophilized powder |
AA Sequence : | MAAGVAAWLPFARAAAIGWMPVASGPMPAPPRQERKRTQDALIVLNVSGTRFQTWQDTLE RYPDTLLGSSERDFFYHPETQQYFFDRDPDIFRHILNFYRTGKLHYPRHECISAYDEELA FFGLIPEIIGDCCYEEYKDRRRENAERLQDDADTDNTGESALPTMTARQRVWRAFENPHT STMALVFYYVTGFFIAVSVIANVVETVPCGSSPGHIKELPCGERYAVAFFCLDTACVMIF TVEYLLRLAAAPSRYRFVRSVMSIIDVVAILPYYIGLVMTDNEDVSGAFVTLRVFRVFRI FKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPAA FWYTIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRAD KRRAQKKARLARIRAAKTGSANAYMQSKRNGLLSNQLQSSEDEQAFVSKSGSSFETQHHH LLHCLEKTTNHEFVDEQVFEESCMEVATGNRPSSHSPSLSSQQGVTSTCCSRRHKKTFRI PNANVSGSHRGSVQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISI PTPPVTTPEGDDRPESPEYSGGNIVRVSAL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KCND2 |
Synonyms | KCND2; Potassium voltage-gated channel subfamily D member 2; Voltage-gated potassium channel subunit Kv4.2 |
UniProt ID | Q8HYZ1 |
◆ Native Proteins | ||
Lectin-1779G | Active Native Griffonia Simplicifolia Lectin I Protein, Biotinylated | +Inquiry |
B. afzelii-21 | Native Borrelia afzelii Antigen | +Inquiry |
Complement C3b-47H | Native Human Complement C3b | +Inquiry |
Pancreas-002H | Human Pancreas Lysate, Total Protein | +Inquiry |
DDIM-6H | Native Human D-dimer protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
INPP5D-5198HCL | Recombinant Human INPP5D 293 Cell Lysate | +Inquiry |
CIAO1-7501HCL | Recombinant Human CIAO1 293 Cell Lysate | +Inquiry |
NOSIP-3758HCL | Recombinant Human NOSIP 293 Cell Lysate | +Inquiry |
RPLP2-1541HCL | Recombinant Human RPLP2 cell lysate | +Inquiry |
GDAP2-5972HCL | Recombinant Human GDAP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KCND2 Products
Required fields are marked with *
My Review for All KCND2 Products
Required fields are marked with *
0
Inquiry Basket