Recombinant Full Length Rat Atp-Binding Cassette Sub-Family B Member 8, Mitochondrial(Abcb8) Protein, His-Tagged
Cat.No. : | RFL13678RF |
Product Overview : | Recombinant Full Length Rat ATP-binding cassette sub-family B member 8, mitochondrial(Abcb8) Protein (Q5RKI8) (39-714aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (39-714) |
Form : | Lyophilized powder |
AA Sequence : | SSCLLRAVAQLRSQLRAHLPRSPPASHRSTSAWCWVGGTLVVPAVLWQHPRFCLIALCEA KGSPPAQPTRARELRFKWKLFWHFLHPHLLALGLAIVLALGAALVNVQIPLLLGQLVEIV AKYTREHVGSFVSESRRLSIQLLLLYGVQGLLTFGYLVLLSHMGERMAMDMRKALFSSLL RQDIAFFDAKKTGQLVSRLTTDVQEFKSSFKLVISQGLRSSTQVIGSLMTLSILSPRLTL MLAVVTPALMGVGTLMGSGLRKLSRQCQEQIARATGVADEALGSVRTVRAFAMEKREEER YQAELESCCCKAEELGRGIALFQGLSNIAFNCMVLGTLFIGGSLVAGQQLKGGDLMSFLV ASQTVQRSMASLSVLFGQVVRGLSAGARVFEYMSLSPVIPLTGGYSIPSKDLRGSITFQN VSFSYPCRPGFNVLKNFTLKLPPGKIVALVGQSGGGKTTVASLLERFYDPTAGVVTLDGH DLRTLDPSWLRGQVIGFISQEPVLFATTIMENIRFGKLDASDEEVYTAARKANAHEFISS FPDGYSTVVGERGTTLSGGQKQRLAIARALIKRPTVLILDEATSALDAESERIVQEALDR ASAGRTVLVIAHRLSTVRAAHSIIVMANGQVCEAGTHEELLQKGGLYAELIRRQALDASL PSAPPAEKPEDHRSCQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Abcb8 |
Synonyms | Abcb8; Mitosur; Mitochondrial potassium channel ATP-binding subunit; ATP-binding cassette sub-family B member 8, mitochondrial; ABCB8; Mitochondrial sulfonylurea-receptor; MITOSUR |
UniProt ID | Q5RKI8 |
◆ Recombinant Proteins | ||
KLK6-2781H | Recombinant Human KLK6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
OTC-3877R | Recombinant Rat OTC Protein, His (Fc)-Avi-tagged | +Inquiry |
MAP1LC3B-2661R | Recombinant Rhesus monkey MAP1LC3B Protein, His-tagged | +Inquiry |
ATP2B2-6645Z | Recombinant Zebrafish ATP2B2 | +Inquiry |
GZMC-7412M | Recombinant Mouse GZMC Protein | +Inquiry |
◆ Native Proteins | ||
CHC-001C | Native Clostridium Histolyticum Collagenase, Tag Free | +Inquiry |
IgG1-225H | Native Human Immunoglobulin G1 (IgG1) | +Inquiry |
BPI-72H | Native Human Bacterial/Permeability-Increasing Protein | +Inquiry |
CXCL9-30233TH | Native Human CXCL9 | +Inquiry |
Lectin-1746M | Active Native Maackia Amurensis Lectin I Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARPC2-8685HCL | Recombinant Human ARPC2 293 Cell Lysate | +Inquiry |
LDLRAD2-4785HCL | Recombinant Human LDLRAD2 293 Cell Lysate | +Inquiry |
SNX10-1604HCL | Recombinant Human SNX10 293 Cell Lysate | +Inquiry |
TIGD4-1076HCL | Recombinant Human TIGD4 293 Cell Lysate | +Inquiry |
VPS41-386HCL | Recombinant Human VPS41 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Abcb8 Products
Required fields are marked with *
My Review for All Abcb8 Products
Required fields are marked with *
0
Inquiry Basket