Recombinant Full Length Cellulose Synthesis Regulatory Protein(Yedq) Protein, His-Tagged
Cat.No. : | RFL2689EF |
Product Overview : | Recombinant Full Length Cellulose synthesis regulatory protein(yedQ) Protein (Q8XB92) (1-564aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-564) |
Form : | Lyophilized powder |
AA Sequence : | MQHETKMENQSWLKKLARRLGPGHIVNLCFIVVLLFSTLLTWREVVVLEDAYISSQRNHL ENVANALDKHLQYNVDKLIFLRNGMREALVAPLDFTSLRDAVTEFEQHRDEHAWQIELNR RRTLSVNGVSDALVSEGNLLSRENESLDNEITAALEVGYLLRLAHNSSSMVEQAMYVSRA GFYVSTQPTLFTRNVPTRYYGYVTQPWFIGHSQRENRHRAVRWFTSQPEHASNTEPQVTV SVPVDSNNYWYGVLGMSIPVRTMQQFLRNAIDKNLDGEYQLYDSKLRFLTSSNPDHPTGN IFDPRELALLAQAMEHDTRGGIRMDSRYVSWERLDHFDGVLVRVHTLSEGVRGDFGSISI ALTLLWALFTTMLLISWYVIRRMVSNMYVLQSSLQWQAWHDTLTRLYNRGALFEKARPLA KLCQTHQHPFSVIQVDLDHFKAINDRFGHQAGDRVLSHAAGLISSSLRAQDVAGRVGGEE FCVILPGASLTEAAEVAERIRLKLNEKEMLIAKSTTIRISASLGVSSSEETGDYDFEQLQ SLADRRLYLAKQAGRNRVFASDNA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dgcQ |
Synonyms | dgcQ; yedQ; Z3047; ECs2694; Probable diguanylate cyclase DgcQ; DGC; Cellulose synthesis regulatory protein |
UniProt ID | Q8XB92 |
◆ Recombinant Proteins | ||
YUKB-2801B | Recombinant Bacillus subtilis YUKB protein, His-tagged | +Inquiry |
ATP4B-654HF | Recombinant Full Length Human ATP4B Protein, GST-tagged | +Inquiry |
HOXB6-6295H | Recombinant Human HOXB6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
C4B-3818H | Recombinant Human C4B protein, His-SUMO-tagged | +Inquiry |
RET-7010H | Recombinant Human RET protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
ALB-03C | Native Cynomolgus Monkey ALB protein | +Inquiry |
Fibrinogen-01S | Native Atlantic salmon Fibrinogen | +Inquiry |
Lecithin-10S | Native Soy Lecithin | +Inquiry |
Vtn-683R | Native Rat Vitronectin | +Inquiry |
PSMA3-419S | Active Native S. aureus PSM-alpha 3 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANKRD37-8851HCL | Recombinant Human ANKRD37 293 Cell Lysate | +Inquiry |
SLC30A1-603HCL | Recombinant Human SLC30A1 lysate | +Inquiry |
SPANXN2-1679HCL | Recombinant Human SPANXN2 cell lysate | +Inquiry |
PTGES3-2712HCL | Recombinant Human PTGES3 293 Cell Lysate | +Inquiry |
LDHAL6B-4789HCL | Recombinant Human LDHAL6B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All dgcQ Products
Required fields are marked with *
My Review for All dgcQ Products
Required fields are marked with *
0
Inquiry Basket