Recombinant Full Length Bovine Coronavirus Hemagglutinin-Esterase(He) Protein, His-Tagged
Cat.No. : | RFL26544BF |
Product Overview : | Recombinant Full Length Bovine coronavirus Hemagglutinin-esterase(HE) Protein (P59709) (19-424aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | BtCoV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (19-424) |
Form : | Lyophilized powder |
AA Sequence : | FDNPPTNVVSHLNGDWFLFGDSRSDCNHVVNTNPRNYSYMDLNPALCDSGKISSKAGNSI FRSFHFTDFYNYTGEGQQIIFYEGLNFTPYHAFKCTTSGSNDIWMQNKGLFYTQVYKNMA VYRSLTFVNVPYVYNGSAQSTALCKSGSLVLNNPAYIAREANFGDYYYKVEADFYLSGCD EYIVPLCIFNGKFLSNTKYYDDSQYYFNKDTGVIYGLNSTETITTGFDFNCHYLVLPSGN YLAISNELLLTVPTKAICLNKRKDFTPVQVVDSRWNNARQSDNMTAVACQPPYCYFRNST TNYVGVYDINHGDAGFTSILSGLLYDSPCFSQQGVFRYDNVSSVWPLYSYGRCPTAADIN TPDVPICVYDPLPLILLGILLGVAVIIIVVLLLYFMVDNGTRLHDA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HE |
Synonyms | HE; 2b; Hemagglutinin-esterase; HE protein; E3 glycoprotein |
UniProt ID | P59709 |
◆ Recombinant Proteins | ||
ZFP410-18928M | Recombinant Mouse ZFP410 Protein | +Inquiry |
VPS4B-8439Z | Recombinant Zebrafish VPS4B | +Inquiry |
Slc51b-5939M | Recombinant Mouse Slc51b Protein, Myc/DDK-tagged | +Inquiry |
B9D1-924R | Recombinant Rat B9D1 Protein | +Inquiry |
PLXNA4-1802H | Recombinant Human PLXNA4, His-tagged | +Inquiry |
◆ Native Proteins | ||
ApoC-I-3557H | Native Human ApoC-I | +Inquiry |
Lectin-1722C | Native Canavalia ensiformis Lectin, Biotin conjugated | +Inquiry |
IgE-01M | Native Mouse IgE protein | +Inquiry |
PLE-105P | Active Native Porcine Esterase | +Inquiry |
APOB-26875TH | Native Human APOB | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAB5B-523HCL | Recombinant Human RAB5B lysate | +Inquiry |
RWDD1-1552HCL | Recombinant Human RWDD1 cell lysate | +Inquiry |
TPD52L1-1813HCL | Recombinant Human TPD52L1 cell lysate | +Inquiry |
NMNAT2-001HCL | Recombinant Human NMNAT2 cell lysate | +Inquiry |
FCER1G-6281HCL | Recombinant Human FCER1G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All HE Products
Required fields are marked with *
My Review for All HE Products
Required fields are marked with *
0
Inquiry Basket