Recombinant Full Length Pseudomonas Syringae Pv. Phaseolicola Macrolide Export Atp-Binding/Permease Protein Macb(Macb) Protein, His-Tagged
Cat.No. : | RFL21773PF |
Product Overview : | Recombinant Full Length Pseudomonas syringae pv. phaseolicola Macrolide export ATP-binding/permease protein MacB(macB) Protein (Q48KB2) (1-656aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas savastanoi pv. phaseolicola |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-656) |
Form : | Lyophilized powder |
AA Sequence : | MQTPLIDLRAIRKSYGGGDSPLVNVLRGIDLSIHAGEFVAIVGASGSGKSTLMNILGCLD RPTSGEYLFAGENVAELGSDELAWLRREAFGFVFQGYHLIPSGSAQENVEMPAIYAGTPA AERHARAAALLDRLGLGSRTGNRPHQLSGGQQQRVSIARALMNGGHIILADEPTGALDSH SGAEVMALLDELASQGHVVILITHDREVAARAKRVIEISDGLVVSDTACDLSAPRSANPA ALQAVDLRKRLSEGSGSRGAWKGELLDAVQAAWRVMWINRFRTALTLLGIVIGVASVVVM LAVGEGSKRQVMAQMSSFGSNIIYLNGKAPNPRAPKGIITLDEVAALGELPEVKMIMPVN GGQAGVRYGNVDHSSYVGGNDTHFPAIFNWPVVEGSYFSEADEQSAAAVAVIGYKVRQKL FGEHTDPIGQYILIENVPFQVVGVLEEKGATSGDLDSDNRIAIPYSAASIRLFGSQDPEY ITIATRDANNVKHAEEAIRNLLQRLHNGKQDYELTNNAAMIQAEARTQNTLSLMLGSIAA ISLLVGGIGVMNIMLMTVRERTREIGIRMATGARQSDILRQFLTEAVMLSVVGGLAGVVL ALGMGAALLLSKVAVAFTVPAVAGAFACALVTGVIFGFMPARKAARLDPVAALTSE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB |
Synonyms | macB; PSPPH_1935; Macrolide export ATP-binding/permease protein MacB |
UniProt ID | Q48KB2 |
◆ Recombinant Proteins | ||
ADORA1-6958Z | Recombinant Zebrafish ADORA1 | +Inquiry |
C20orf112-301428H | Recombinant Human C20orf112 protein, GST-tagged | +Inquiry |
GP120-5227H | Recombinant HIV-1 GP120, His-tagged | +Inquiry |
INHBE-2724R | Recombinant Rat INHBE Protein, His (Fc)-Avi-tagged | +Inquiry |
Tigit-016M | Recombinant Mouse Tigit Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
C-type lectin like protein-043H | Native Hen C-type lectin like protein Protein, Peroxidase conjugated | +Inquiry |
CTSH-27404TH | Native Human CTSH | +Inquiry |
TroponinCIT-33HFL | Native Full Length Human Cardiac Troponin C-I-T Complex | +Inquiry |
KNG1-29146TH | Native Human KNG1 | +Inquiry |
Lectin-1839S | Active Native Sambucus Nigra Lectin Protein, Cy3 labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
HEK293-014HCL | Human Insulin Stimulated HEK293 Whole Cell Lysate | +Inquiry |
LSM11-4611HCL | Recombinant Human LSM11 293 Cell Lysate | +Inquiry |
BTLA-732CCL | Recombinant Cynomolgus BTLA cell lysate | +Inquiry |
FBXW4-6284HCL | Recombinant Human FBXW4 293 Cell Lysate | +Inquiry |
EMP1-6607HCL | Recombinant Human EMP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All macB Products
Required fields are marked with *
My Review for All macB Products
Required fields are marked with *
0
Inquiry Basket