Recombinant Full Length Hyphomonas Neptunium Macrolide Export Atp-Binding/Permease Protein Macb(Macb) Protein, His-Tagged
Cat.No. : | RFL11826HF |
Product Overview : | Recombinant Full Length Hyphomonas neptunium Macrolide export ATP-binding/permease protein MacB(macB) Protein (Q0C1N8) (1-645aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Hyphomonas neptunium |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-645) |
Form : | Lyophilized powder |
AA Sequence : | MTPPLIELKDVTRYYGSGDTEVRALDGVSLTIETGEFVAIVGQSGSGKSTLMNLLGCLDR PTNGRYAIRGQNVSELDPDNLAALRRETFGFIFQRYNLLASVSASENVEIPAVYAGLALS ERREKAAGLLAKLGLGERVHHKPGQLSGGQQQRVAVARALVNDAEVILADEPTGALDSGS SNDLLNLLEELHASGRTIILITHDQKVAARAKRVIEIRDGKIISDSGNKQAAAEEAPQYR YARKGPSPIAQVAESVKMAFRSLRANLFRTALTLLGVVIGVSAVVAMLAIGEGSRAEVMA RFESMGPNLLFVRPGAPGTRMRGGAIATLTLEDAQALGELENILAAVPSRSTNATLRNGG NDYSSSIEGVSETWPIAQNRDMLYGTFFTKDDVDRRIGAVVLGTTTAGNLFDDIESAVGQ YVFLGGAPFEVAGILESKGASSWGQDQDDIALVPITTGMMRLFGQSYLSSITLAVDDTDR ITETEAAAHAFLLARHGTEDFQIRNTASILASVEETQNSFSILLGSVAAISLLVGGIGVM NIMLVSVSERTREIGVRMATGARRSDIQTQFIVESLVVGGLGGIAGVAIGFGIVFIIAQM GMTVAVTPLPAILAFSSALGTGLVFGLLPARQASRLDPVAALASE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB |
Synonyms | macB; HNE_1647; Macrolide export ATP-binding/permease protein MacB |
UniProt ID | Q0C1N8 |
◆ Recombinant Proteins | ||
CD4-151H | Recombinant Human CD4 Protein, DYKDDDDK-tagged | +Inquiry |
DCLK2-2394H | Recombinant Human DCLK2 Protein, GST-tagged | +Inquiry |
KRAS-03H | Recombinant Human KRAS Protein, DYKDDDDK-tagged | +Inquiry |
DYNC1LI1-2777H | Recombinant Human DYNC1LI1 Protein, His-tagged | +Inquiry |
RFL25175PF | Recombinant Full Length Picea Sitchensis Casp-Like Protein 9 Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
F2-5286R | Native Rat Coagulation Factor II | +Inquiry |
VCL-899T | Native Turkey VCL Protein | +Inquiry |
MPO -27H | Active Native Human Myeloperoxidase | +Inquiry |
Lectin-1765D | Active Native Datura Stramonium Lectin Protein, Agarose bound | +Inquiry |
F7-5303H | Native Human Coagulation Factor VII, R-PE conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
SkeletalMuscles-543E | Equine Skeletal Muscles Lysate, Total Protein | +Inquiry |
OTOP2-1262HCL | Recombinant Human OTOP2 cell lysate | +Inquiry |
IGFBP4-2925MCL | Recombinant Mouse IGFBP4 cell lysate | +Inquiry |
PRMT1-500HCL | Recombinant Human PRMT1 lysate | +Inquiry |
MIER2-4317HCL | Recombinant Human MIER2 293 Cell Lysate | +Inquiry |
See All Skeletal Muscles Total Protein Cell & Tissue Lysates |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All macB Products
Required fields are marked with *
My Review for All macB Products
Required fields are marked with *
0
Inquiry Basket