Recombinant Full Length Escherichia Coli O6:K15:H31 Macrolide Export Atp-Binding/Permease Protein Macb(Macb) Protein, His-Tagged
Cat.No. : | RFL34188EF |
Product Overview : | Recombinant Full Length Escherichia coli O6:K15:H31 Macrolide export ATP-binding/permease protein MacB(macB) Protein (Q0TJH0) (1-648aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-648) |
Form : | Lyophilized powder |
AA Sequence : | MTPLLELKDIRRSYPAGDEQVEVLKGISLDIYAGEMVAIVGASGSGKSTLMNILGCLDKA TSGTYRVAGQDVATLDADALAQLRREHFGFIFQRYHLLSHLTAEQNVEVPAVYAGLERKQ RLLRAQELLQRLGLEDRTEYYPAQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSG EEVMAILHQLRDRGHTVIIVTHDPQVAAQAERVIEIRDGEIVRNPPAVEKVNATGGTEPV VNTASGWRQFVSGFNEALTMAWRALAANKMRTLLTMLGIIIGIASVVSIVVVGDAAKQMV LADIRSIGTNTIDVYPGNDFGDDDPQYQQALKYDDLIAIQKQPWVASATPAVSQNLRLRY NNVDVAASANGVSGDYFNVYGMTFSEGNTFNQEQLNGRAQVVVLDSNTRRQLFPHKADVV GEVILVGNMPARVIGVAEEKQSMFGSSKVLRVWLPYSTMSGRVMGQSWLNSITVRVKEGF DSAEAEQQLTRLLSLRHGKKDFFTWNMDGVLKTVEKTTRTLQLFLTLVAVISLVVGGIGV MNIMLVSVTERTREIGIRMAVGARASDVLQQFLIEAVLVCLVGGALGITLSLLIAFTLQL FLPGWEIGFSPLALLLAFLCSTVTGILFGWLPARNAARLDPVDALARE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB |
Synonyms | macB; ECP_0894; Macrolide export ATP-binding/permease protein MacB |
UniProt ID | Q0TJH0 |
◆ Recombinant Proteins | ||
SUMO2-28787TH | Recombinant Human SUMO2 | +Inquiry |
Tnfsf11-953M | Active Recombinant Mouse Tnfsf11 Protein, His-tagged | +Inquiry |
IL27RA-876HFL | Recombinant Full Length Human IL27RA Protein, C-Flag-tagged | +Inquiry |
KCNJ11-2179R | Recombinant Rhesus Macaque KCNJ11 Protein, His (Fc)-Avi-tagged | +Inquiry |
TRIM16-0414H | Recombinant Human TRIM16 Protein (A2-P564), Tag Free | +Inquiry |
◆ Native Proteins | ||
Troponin-18H | Native Human Cardiac Troponin complex | +Inquiry |
SNCA-27342TH | Native Human SNCA | +Inquiry |
APOC1-27330TH | Native Human APOC1 | +Inquiry |
Lectin-1731R | Active Native Ricinus Communis Agglutinin I Protein, Rhodamine labeled | +Inquiry |
Fva-285B | Active Native Bovine Factor Va | +Inquiry |
◆ Cell & Tissue Lysates | ||
SAMHD1-2072HCL | Recombinant Human SAMHD1 293 Cell Lysate | +Inquiry |
TRIM8-1837HCL | Recombinant Human TRIM8 cell lysate | +Inquiry |
SLC35B2-606HCL | Recombinant Human SLC35B2 lysate | +Inquiry |
DRD1-6818HCL | Recombinant Human DRD1 293 Cell Lysate | +Inquiry |
TEPP-1147HCL | Recombinant Human TEPP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All macB Products
Required fields are marked with *
My Review for All macB Products
Required fields are marked with *
0
Inquiry Basket