Recombinant Full Length Pseudomonas Aeruginosa Upf0060 Membrane Protein Pspa7_1846 (Pspa7_1846) Protein, His-Tagged
Cat.No. : | RFL31435PF |
Product Overview : | Recombinant Full Length Pseudomonas aeruginosa UPF0060 membrane protein PSPA7_1846 (PSPA7_1846) Protein (A6V2E4) (1-109aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas aeruginosa |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-109) |
Form : | Lyophilized powder |
AA Sequence : | MINYLWFVLAAFCEIAGCYAFYLWLRLGKSALWVLPGLLSLSLFALLLTRVEASYAGRAY AAYGGIYVAASLFWLAFVERSRPLWSDWLGVALCVLGASIVLFGPRLSQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PSPA7_1846 |
Synonyms | PSPA7_1846; UPF0060 membrane protein PSPA7_1846 |
UniProt ID | A6V2E4 |
◆ Native Proteins | ||
Prothrombin-271B | Active Native Bovine Prothrombin Frag 1 | +Inquiry |
Collagen-319H | Native Human Collagen Type II | +Inquiry |
MPO-01H | Active Native Human MPO Protein | +Inquiry |
Collagen Type I-04H | Native Human Collagen Type I | +Inquiry |
PAP-01H | Active Native Human PAP | +Inquiry |
◆ Cell & Tissue Lysates | ||
DAND5-7080HCL | Recombinant Human DAND5 293 Cell Lysate | +Inquiry |
MARVELD3-1063HCL | Recombinant Human MARVELD3 cell lysate | +Inquiry |
COL9A1-758HCL | Recombinant Human COL9A1 cell lysate | +Inquiry |
ATP6V0B-149HCL | Recombinant Human ATP6V0B cell lysate | +Inquiry |
SCYL3-2016HCL | Recombinant Human SCYL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PSPA7_1846 Products
Required fields are marked with *
My Review for All PSPA7_1846 Products
Required fields are marked with *
0
Inquiry Basket