Recombinant Full Length Pseudomonas Aeruginosa Flagellar M-Ring Protein(Flif) Protein, His-Tagged
Cat.No. : | RFL16854PF |
Product Overview : | Recombinant Full Length Pseudomonas aeruginosa Flagellar M-ring protein(fliF) Protein (Q51463) (1-598aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas aeruginosa |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-598) |
Form : | Lyophilized powder |
AA Sequence : | MADALIDSQVPAKSGGAGMLKKSFPGLSFLDNLSEMTMLRQIGLLVGLAASVAIGFAVVL WSQQPDYKPLYGSLNGVDANRVVEALTAADIPYKVEPNSGALLVKADDLGRARMKVASAG VAPTDNNVGFEILDKEQALGTSQFMEATNYRRGLEGELARTVSSLNNVKAARVHLAIPKS SVFVRDDRKPSASVLVELYPGRSLEPSQVMAIVNLVATSVPELDKSQVTVVDQKGNLLSD QQELSELTMAGKQFDFTRRMEGLLTQRVHNILQPVLGNGRYKAEVSADVDFSAVESTSEM YNPDQPALRSEQRNNEERQNSSGPQGVPGALSNQPPGPASAPQQATASAPADYVAPGQPL KDANGQTIIDPKTGKPELAPYPTDKRDQTTRNYELDRSISYTKQQQGRLRRLSVAVVLDD QMKVDAKTGEVSHQPWSADELARFTRLVQDSVGYDASRGDSVSVINAPFAPAQAEEIDSI PFYSQPWFWDIVKQVLGVLFILVLVFGVLRPVLSNITGGGKGKSLAGGGGRDGDLALGES GLEGSLADDRVSIGGPSSILLPSPTEGYDAQLNAIKNLVAQDPGRVAQVVKEWINADE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | fliF |
Synonyms | fliF; PA1101; Flagellar M-ring protein |
UniProt ID | Q51463 |
◆ Recombinant Proteins | ||
Erbb3-2515MF | Recombinant Mouse Erbb3 Protein, His-tagged, FITC conjugated | +Inquiry |
IL13RA2-3506C | Recombinant Chicken IL13RA2 | +Inquiry |
CHEB-0970B | Recombinant Bacillus subtilis CHEB protein, His-tagged | +Inquiry |
ANKRD13B-573H | Recombinant Human ANKRD13B protein, GST-tagged | +Inquiry |
Mtarc2-3955M | Recombinant Mouse Mtarc2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
cpe-001C | Active Native C. perfringens Enterotoxin | +Inquiry |
SERPINE1-5514R | Native Rabbit Serpin Peptidase Inhibitor, Clade E (nexin, plasminogen activator inhibitor type 1), Member 1 | +Inquiry |
ATF-177D | Native Dog Apotransferrin | +Inquiry |
Lectin-1727W | Native Wheat Germ Lectin, Biotin conjugated | +Inquiry |
CELA1-52P | Active Native Porcine pancreatic elastase | +Inquiry |
◆ Cell & Tissue Lysates | ||
SMOX-1655HCL | Recombinant Human SMOX 293 Cell Lysate | +Inquiry |
EPCAM-2525HCL | Recombinant Human EPCAM cell lysate | +Inquiry |
CHRM1-7521HCL | Recombinant Human CHRM1 293 Cell Lysate | +Inquiry |
KCNMB4-5022HCL | Recombinant Human KCNMB4 293 Cell Lysate | +Inquiry |
SLC22A8-1790HCL | Recombinant Human SLC22A8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All fliF Products
Required fields are marked with *
My Review for All fliF Products
Required fields are marked with *
0
Inquiry Basket