Recombinant Full Length Salmonella Typhimurium Flagellar M-Ring Protein(Flif) Protein, His-Tagged
Cat.No. : | RFL8804SF |
Product Overview : | Recombinant Full Length Salmonella typhimurium Flagellar M-ring protein(fliF) Protein (P15928) (2-560aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella typhimurium |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-560) |
Form : | Lyophilized powder |
AA Sequence : | SATASTATQPKPLEWLNRLRANPRIPLIVAGSAAVAIVVAMVLWAKTPDYRTLFSNLSDQ DGGAIVAQLTQMNIPYRFANGSGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKF GISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPKPSLFVREQKSPSASVTVTLE PGRALDEGQISAVVHLVSSAVAGLPPGNVTLVDQSGHLLTQSNTSGRDLNDAQLKFANDV ESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQTEEHYSPNGDASKATLRSRQLNIS EQVGAGYPGGVPGALSNQPAPPNEAPIATPPTNQQNAQNTPQTSTSTNSNSAGPRSTQRN ETSNYEVDRTIRHTKMNVGDIERLSVAVVVNYKTLADGKPLPLTADQMKQIEDLTREAMG FSDKRGDTLNVVNSPFSAVDNTGGELPFWQQQSFIDQLLAAGRWLLVLVVAWILWRKAVR PQLTRRVEEAKAAQEQAQVRQETEEAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSD NDPRVVALVIRQWMSNDHE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | fliF |
Synonyms | fliF; fla; AII.1; BI; STM1969; Flagellar M-ring protein |
UniProt ID | P15928 |
◆ Recombinant Proteins | ||
SLC16A14-8232M | Recombinant Mouse SLC16A14 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ube2s-6798M | Recombinant Mouse Ube2s Protein, Myc/DDK-tagged | +Inquiry |
DPP4-608H | Active Recombinant Human DPP4 Protein, His-tagged | +Inquiry |
PTGR1-3084C | Recombinant Chicken PTGR1 | +Inquiry |
RFL9255RF | Recombinant Full Length Rhodococcus Erythropolis Atp Synthase Subunit A(Atpb) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
PGK-100Y | Active Native Yeast 3-Phosphoglyceric Phosphokinase | +Inquiry |
HBA1-5284H | Native Human Hemoglobin, Alpha 1 | +Inquiry |
COL1A1-26195TH | Native Human COL1A1 | +Inquiry |
CPD A-036H | Active Native Human Pancreatic Carboxypeptidase A | +Inquiry |
KRT19-40H | Native Human KRT19 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCML2-2032HCL | Recombinant Human SCML2 293 Cell Lysate | +Inquiry |
FN3K-6177HCL | Recombinant Human FN3K 293 Cell Lysate | +Inquiry |
CDC73-7645HCL | Recombinant Human CDC73 293 Cell Lysate | +Inquiry |
MPV17-4222HCL | Recombinant Human MPV17 293 Cell Lysate | +Inquiry |
PHGDH-3223HCL | Recombinant Human PHGDH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All fliF Products
Required fields are marked with *
My Review for All fliF Products
Required fields are marked with *
0
Inquiry Basket