Recombinant Full Length Progestin And Adipoq Receptor-Like Protein 1(Paqr-1) Protein, His-Tagged
Cat.No. : | RFL35838CF |
Product Overview : | Recombinant Full Length Progestin and adipoq receptor-like protein 1(paqr-1) Protein (Q94177) (1-434aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-434) |
Form : | Lyophilized powder |
AA Sequence : | MNPDEVNRALGHYLNDADSGELVVEDSTTVQVKNPEARKTGDKIEVFYSRKTTVVSPTNS DDEDADFCSDSELLPQQEGHRSRATSFAGRIRAGSDDEAMPKHTILRYRRKKGGQWREIN LQGTPDKRKDDEDELEVDVKEDRSEQTGIVTKTYEARWKVLKYEHLPEWLQDNEFLRHGH RPPLPSFSECFKSIWSLHTETGNIWTHLIGCVAFFFLACWFLTRPDNHIQFQEKVVFSFF FAGAVLCLGLSFAFHTLSCHSVNVVKIFCKLDYMGISLLIIGSFIPWIYYGFYCRREPKI TYIAMVSVLGIGAIVVSLWDKFSESRFRPIRAAVFVGMGCSGVIPTIHYIITDGVHSLFA DNSFHWLLLMAFLYLLGAGLYATRTPERFFPGKCDIWFQSHQLFHTCVVIAAFVHYYGIS EMAFARLNEQCPVR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | paqr-1 |
Synonyms | paqr-1; C43G2.1; Progestin and adipoQ receptor-like protein 1 |
UniProt ID | Q94177 |
◆ Recombinant Proteins | ||
TP53-1162CAF555 | Active Recombinant Cynomolgus TP53 Protein, Alexa Fluor 555 conjugated | +Inquiry |
HA-0377H | Recombinant Influenza A H7N9 (A/Pigeon/Shanghai/S1069/2013) HA protein, His-tagged | +Inquiry |
CCNA2-0648H | Recombinant Human CCNA2 Protein, GST-Tagged | +Inquiry |
PACRGL-3429HF | Recombinant Full Length Human PACRGL Protein, GST-tagged | +Inquiry |
SCARECROW-3857H | Recombinant Human SCARECROW protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Troponin-18H | Native Human Cardiac Troponin complex | +Inquiry |
AK-14B | Active Native Bacillus stearothermophilus Acetate Kinase | +Inquiry |
Lectin-1766D | Active Native Datura Stramonium Lectin Protein, Biotinylated | +Inquiry |
Egf -635R | Native Rat Egf protein | +Inquiry |
HBA2-27786TH | Native Human HBA2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
JOSD2-5098HCL | Recombinant Human JOSD2 293 Cell Lysate | +Inquiry |
RPS6-567HCL | Recombinant Human RPS6 lysate | +Inquiry |
CTNNB1-563HCL | Recombinant Human CTNNB1 cell lysate | +Inquiry |
TYK2-1867HCL | Recombinant Human TYK2 cell lysate | +Inquiry |
C2orf28-8084HCL | Recombinant Human C2orf28 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All paqr-1 Products
Required fields are marked with *
My Review for All paqr-1 Products
Required fields are marked with *
0
Inquiry Basket