Recombinant Full Length Human PACRGL Protein, GST-tagged

• Cat.No.: PACRGL-3429HF
• Product Overview: Human PACRGL full-length ORF (NP_659485.1, 1 a.a. - 221 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 221 amino acids
• Description: PACRGL (Parkin Coregulated Like) is a Protein Coding gene. GO annotations related to this gene include binding. An important paralog of this gene is PACRG.
• Molecular Mass: 50.5 kDa
• AA Sequence: MQKSEGSGGTQLKNRATGNYDQRTSSSTQLKHRNAVQGSKSSLSTSSPESARKLHPRPSDKLNPKTINPFGEQSRVPSAFAAIYSKGGIPCRLVHGSVKHRLQWECPPESLSFDPLLITLAEGLRETKHPYTFVSKEGFRELLLVKGAPEKAIPLLPRLIPVLKAALVHSDDEVFERGLNALVQLSVVVGPSLNDHLKHLLTSGSLSIIKSKIPTYCSICC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PACRGL PARK2 co-regulated-like [ Homo sapiens ]
• Official Symbol: PACRGL
• Synonyms: PACRGL; PARK2 co-regulated-like; C4orf28, chromosome 4 open reading frame 28; PACRG-like protein; MGC29898; C4orf28
• Gene ID: 133015
• mRNA Refseq: NM_001130727
• Protein Refseq: NP_001124199
• UniProt ID: Q8N7B6