Recombinant Full Length Populus Trichocarpa Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL23650PF |
Product Overview : | Recombinant Full Length Populus trichocarpa Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (A4GYT7) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLLAVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTITNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQS VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVGTGLAENQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAIGWLGHPLFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGSRTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTRRQVV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Poptr_cp049; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | A4GYT7 |
◆ Recombinant Proteins | ||
SE1169-3282S | Recombinant Staphylococcus epidermidis ATCC 12228 SE1169 protein, His-tagged | +Inquiry |
CCDC92-2909HF | Recombinant Full Length Human CCDC92 Protein, GST-tagged | +Inquiry |
KREMEN2-0315M | Recombinant Mouse KREMEN2 protein, His-tagged | +Inquiry |
SLC41A2-815H | Recombinant Human SLC41A2 Protein (1-162 aa), His-tagged | +Inquiry |
NI36-RS01325-1102S | Recombinant Staphylococcus aureus (strain: MS4, nat-host: Homo sapiens) NI36_RS01325 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
FGG -41B | Native Bovine Fibrinogen, FITC Labeled | +Inquiry |
GFAP-526H | Native Human GFAP protein | +Inquiry |
S-52H | Native Human Protein S | +Inquiry |
COL5-136H | Native Human Collagen Type IV | +Inquiry |
F7-5303H | Native Human Coagulation Factor VII, R-PE conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM46B-6375HCL | Recombinant Human FAM46B 293 Cell Lysate | +Inquiry |
COX6B2-7328HCL | Recombinant Human COX6B2 293 Cell Lysate | +Inquiry |
EZH1-6488HCL | Recombinant Human EZH1 293 Cell Lysate | +Inquiry |
MAOA-4517HCL | Recombinant Human MAOA 293 Cell Lysate | +Inquiry |
MKKS-1114HCL | Recombinant Human MKKS cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket