Recombinant Full Length Gossypium Barbadense Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL20218GF |
Product Overview : | Recombinant Full Length Gossypium barbadense Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (A0ZZ61) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Gossypium barbadense (Sea-island cotton) (Egyptian cotton) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTITNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPCGLTGKVQP VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKDGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTRRQVV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | A0ZZ61 |
◆ Recombinant Proteins | ||
RFL36853XF | Recombinant Full Length Xenopus Laevis D(1C) Dopamine Receptor Protein, His-Tagged | +Inquiry |
Map3k1-3204M | Recombinant Mouse Map3k1 protein, His-tagged | +Inquiry |
CLDN22-1731M | Recombinant Mouse CLDN22 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL36187PF | Recombinant Full Length Pisum Sativum Protein Tic 40, Chloroplastic(Tic40) Protein, His-Tagged | +Inquiry |
UBE2D3-205H | Recombinant Human UBE2D3, His-tagged | +Inquiry |
◆ Native Proteins | ||
LDH-215S | Active Native Porcine Lactate Dehydrogenase | +Inquiry |
Lectin-1769D | Active Native Dolichos Biflorus Agglutinin Protein, Biotinylated | +Inquiry |
BLA-01B | Native Bovine β-Lactoglobulin Protein | +Inquiry |
CVB6-14 | Native Coxsackievirus B6 Antigen | +Inquiry |
TNNT2-4655H | Native Human Troponin T Type 2 (Cardiac) | +Inquiry |
◆ Cell & Tissue Lysates | ||
Testis-509H | Human Testis Liver Cirrhosis Lysate | +Inquiry |
FNDC8-6171HCL | Recombinant Human FNDC8 293 Cell Lysate | +Inquiry |
ZFP36-181HCL | Recombinant Human ZFP36 293 Cell Lysate | +Inquiry |
DND1-230HCL | Recombinant Human DND1 lysate | +Inquiry |
EIF4E-6651HCL | Recombinant Human EIF4E 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket