Recombinant Full Length Populus Deltoides Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL29173PF |
Product Overview : | Recombinant Full Length Populus deltoides Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (O03061) (1-509aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Populus deltoides (Eastern poplar) (Eastern cottonwood) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-509) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVELNDPGRLLAVHMMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITKSWGGWSITGGTITNPGIWSYEGVAGSHIVFSGLCFLAAIWHWVYWDL EIFCDDRTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQS VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVGTGLAENQSLS EAWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAIGWLGHPLIRDKEGRDVFVRRI PTFFETFRVVLDDDDGMVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKK YARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGSRTLFRDVF AGIDPDLDAQVEFGAFQKLGDPTTRRQVV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | O03061 |
◆ Recombinant Proteins | ||
RFL731HF | Recombinant Full Length Human Protein Tweety Homolog 2(Ttyh2) Protein, His-Tagged | +Inquiry |
RFL26520CF | Recombinant Full Length Chapare Virus Pre-Glycoprotein Polyprotein Gp Complex(Gpc) Protein, His-Tagged | +Inquiry |
MMP19-6465HF | Recombinant Full Length Human MMP19 Protein, GST-tagged | +Inquiry |
ACSM5-476R | Recombinant Rat ACSM5 Protein | +Inquiry |
ITGA2B-2615H | Recombinant Human ITGA2B Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
C3d-48HB | Native Human Complement C3d Protein, Biotinylated | +Inquiry |
GPT-188S | Active Native Swine Glutamate Pyruvate Transaminase | +Inquiry |
FG-163B | Native Bovine fibrinogen | +Inquiry |
KNG1-18H | Native Human Kininogen, LMW | +Inquiry |
Lectin-1739H | Active Native Hippeastrum Hybrid (Amaryllis) Lectin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRKCH-2855HCL | Recombinant Human PRKCH 293 Cell Lysate | +Inquiry |
ZNF37A-2019HCL | Recombinant Human ZNF37A cell lysate | +Inquiry |
INHBA-2078MCL | Recombinant Mouse INHBA cell lysate | +Inquiry |
COLEC10-001CCL | Recombinant Cynomolgus COLEC10 cell lysate | +Inquiry |
CPB-1276RH | Rabbit Anti-Human BMP 7 Polyclonal Antibody | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket