Recombinant Full Length Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL9901LF |
Product Overview : | Recombinant Full Length Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (Q9BBQ8) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Lotus japonicus (Lotus corniculatus var. japonicus) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLLAVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWNITGGTITNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFSDERTGKPSLDLPKIFGIHLFLAGLACFGFGAFHVTGLYGPGIWVSDPYGLTGRVQP VNPAWGVEGFDPFVPGGVASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVGAGLAENQSFSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGSRTLFRDVFA GIDPDLDSQVEFGAFQKLGDPTTRRQVV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | Q9BBQ8 |
◆ Recombinant Proteins | ||
ACE2-0464H | Recombinant Human ACE2 Protein (M1-S740), Tag Free | +Inquiry |
INS-5100H | Recombinant Human INS Protein, GST-tagged | +Inquiry |
FGG-2342R | Recombinant Rat FGG Protein | +Inquiry |
KRTAP4-1-1573H | Recombinant Human KRTAP4-1 | +Inquiry |
SCO2504-1254S | Recombinant Streptomyces coelicolor A3(2) SCO2504 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IgGF-330C | Native Chicken IgG Fab | +Inquiry |
LOX1.1-61S | Native soybeans LOX1.1 Protein | +Inquiry |
Lectin-1829P | Active Native Pisum Sativum Agglutinin Protein | +Inquiry |
LDL-243H | Native Human Lipoproteins, Intermediate Density | +Inquiry |
Collagen-60H | Native Human Collagen Type II | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM122B-6442HCL | Recombinant Human FAM122B 293 Cell Lysate | +Inquiry |
GTF3C6-5688HCL | Recombinant Human GTF3C6 293 Cell Lysate | +Inquiry |
SIGLEC12-1605HCL | Recombinant Human SIGLEC12 cell lysate | +Inquiry |
HTN1-827HCL | Recombinant Human HTN1 cell lysate | +Inquiry |
RING1-2337HCL | Recombinant Human RING1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket