Recombinant Full Length Odontella Sinensis Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL14365OF |
Product Overview : | Recombinant Full Length Odontella sinensis Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (P49471) (1-509aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Odontella sinensis (Marine centric diatom) (Biddulphia sinensis) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-509) |
Form : | Lyophilized powder |
AA Sequence : | MALPWYRVHTVVLNDPGRLIAVHLMHTALVAGWAGSMALYELAVFDPSDPVLNPMWRQGM FVMPFMTRLGITDSWGGWSITGESVSNPGIWSFEGVALSHIILSGMCFLAAIWHWVYWDL ELFRDPRTGEPALDLPKIFGIHLFLSGLLCFGFGAFHVTGLFGPGIWVSDAYGVTGKVQP VAPAWGADGFNPFNPGGIAAHHIAAGIFGIFAGIFHLTVRPPQRLYRALRMGNIETVLSS SIAAVFFAAFVTSGTMWYGAAATPIELFGPTRYQWDSGYFQQEIERQVETSVSEGLSESQ AWSRIPDKLAFYDYIGNNPAKGGLFRAGPMNKGDGIAEAWLGHPIFRDKDGRELTVRRMP AFFETFPVILVDKDGIIRADIPFRRAESKYSIEQVGVTVDFYGGKLNGQTFKDAPTVKKF ARKAQLGEVFEFDRTSLESDGVFRSSPRGWYTFGHANFALLFFFGHLWHGGRTIFRDVFT GIGAEVTEQVEFGAFQKLGDKSTKKQGAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | P49471 |
◆ Recombinant Proteins | ||
EPGN-4830H | Recombinant Human EPGN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL20687DF | Recombinant Full Length Drosophila Melanogaster Dopamine D2-Like Receptor(D2R) Protein, His-Tagged | +Inquiry |
Pink1-1804M | Recombinant Mouse Pink1 protein, His & T7-tagged | +Inquiry |
FGG-2431H | Recombinant Human FGG Protein (Lys166-Asn416), His tagged | +Inquiry |
UCN-17786M | Recombinant Mouse UCN Protein | +Inquiry |
◆ Native Proteins | ||
LDL-401H | Native Human Low Density Lipoprotein, Medium Oxidized, DiI labeled | +Inquiry |
Spinal Cord-010H | Human Spinal Cord Lysate, Total Protein | +Inquiry |
ELANE-8236H | Native Human Neutrophil Elastase (ELA-2) | +Inquiry |
F5-284B | Active Native Bovine Factor V | +Inquiry |
Lectin-1735P | Active Native Peanut Agglutinin Protein, Rhodamine labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHMP1B-7533HCL | Recombinant Human CHMP1B 293 Cell Lysate | +Inquiry |
GNGT1-722HCL | Recombinant Human GNGT1 cell lysate | +Inquiry |
MOCS3-4259HCL | Recombinant Human MOCS3 293 Cell Lysate | +Inquiry |
KIF22-927HCL | Recombinant Human KIF22 cell lysate | +Inquiry |
ZP3-2099HCL | Recombinant Human ZP3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket