Recombinant Full Length Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL13072CF |
Product Overview : | Recombinant Full Length Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (P48103) (1-509aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cyanophora paradoxa |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-509) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLIAVHLMHTALVAGWAGSMALYEIAVFDPSDPVLNPMWRQGM FVLPFMVRLGITNSWGGWTINGENVTDPGFWSFEGVAAAHIGLSGLLFLAAIWHWVYWDL ELFRDPRTGEPALDLPKMFGIHLFLSGLLCFGFGAFHLTGLFGPGMWVSDAYSITGRVQP VAPAWGPEGFNPFNPGGVVSHHIAAGIVGILAGLFHLSVRPPQRLYKALRMGNIETVLSS SISAVFFAAFIVAGTMWYGSAATPVELFGPTRYQWDQEYFHQEMERRVQKDVAAGASLSE AWNRIPAKLAFYDYIGNNPAKGGLFRAGPMNKGDGIAESWLGHATFKDKEGRELTVRRMP TFFETFPVVLIDKDGVLRADIPFRRAESKYSIEQMGVTVSFYGGKLDGQTFTDAPTVKKY ARKAQLGEAFEFDRETLKSDGVFRSSARGWFTFGHASFALIFFFGHLWHGGRTLFRDVFA GIGEEVTEQVEFGAFQKVGDKTTRKQEAG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | P48103 |
◆ Recombinant Proteins | ||
IL13-28497TH | Recombinant Human IL13 | +Inquiry |
LILRB1-0332H | Recombinant Human LILRB1 protein, His-Avi-tagged, Biotinylated | +Inquiry |
BACH1B-2831Z | Recombinant Zebrafish BACH1B | +Inquiry |
VEGFA-309H | Recombinant Human VEGFA protein | +Inquiry |
RFL36394NF | Recombinant Full Length Nicotiana Sylvestris Photosystem Ii D2 Protein(Psbd) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Protein S-90H | Native Human Protein S | +Inquiry |
RBP4-247H | Native Human Retinol Binding Protein 4 | +Inquiry |
SERPING1-97H | Active Native Human C1 Esterase Inhibitor (C1-INH) | +Inquiry |
Collagen Type I-01B | Native Bovine Collagen Type I (Atelocollagen) Protein | +Inquiry |
TF-102H | Native Human Transferrin (HOLO) | +Inquiry |
◆ Cell & Tissue Lysates | ||
U251-010WCY | Human Glioma U251 Whole Cell Lysate | +Inquiry |
FAM136A-6424HCL | Recombinant Human FAM136A 293 Cell Lysate | +Inquiry |
ALDH1A1-8922HCL | Recombinant Human ALDH1A1 293 Cell Lysate | +Inquiry |
CTRC-1720HCL | Recombinant Human CTRC cell lysate | +Inquiry |
UQCRH-486HCL | Recombinant Human UQCRH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket