Recombinant Full Length Chara Vulgaris Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL34265CF |
Product Overview : | Recombinant Full Length Chara vulgaris Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (Q1ACH5) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chara vulgaris (Common stonewort) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLIAVHIMHTALVSGWAGSMALYELAVFDPSDPILDPMWRQGM FVIPFMTRLGITKSWGGWSITGETITNPGIWSYEGVAAVHIILSGLLFLAAIWHWVYWDL ELFRDERTGKPALDLPKIFGIHLFLSGLLCFGFGAFHVTGLFGPGIWISDPYGITGKVQS VSPAWGAEGFDPFNPGGIASHHIAAGILGILAGLFHLSVRPPQRLYKALRMGNVETVLSS SIAAVFFAAFIVSGTMWYGSAATPIELFGPTRYQWDQGYFQQEIDRRVRLSTSQGFSISE AWSRIPEKLAFYDYIGNNPAKGGLFRAGPMDNGDGIAVGWLGHAVFKDKEGHELFVRRMP TFFETFPVVLVDEEGIIRADLPFRRAESKYSIEQVGVTVEFYGGELDNVSFSDPATVKKY ARRAQLGEIFEFDRTTLKSDGVFRSSPRGWFTFGHLCFALLFFFGHIWHGARTLFRDVFA GIDPDIDSQIEFGIFQKLGDPTTKKQTV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | Q1ACH5 |
◆ Recombinant Proteins | ||
UNC13A-4948H | Recombinant Human UNC13A protein, His-tagged | +Inquiry |
AGPAT4-1420M | Recombinant Mouse AGPAT4 Protein | +Inquiry |
RFL12341DF | Recombinant Full Length Desulfovibrio Desulfuricans Atp Synthase Subunit C(Atpe) Protein, His-Tagged | +Inquiry |
Dnase2b-1359R | Recombinant Rat Dnase2b Protein, His&GST-tagged | +Inquiry |
NAALAD2-1070H | Recombinant Human NAALAD2 | +Inquiry |
◆ Native Proteins | ||
AK1-6667C | Active Native Chicken AK1 | +Inquiry |
APOB-613H | Native Human Apolipoprotein B (including Ag(x) antigen) | +Inquiry |
C4B-10H | Native Human C4B Protein | +Inquiry |
IGHA2-615H | Native Human Immunoglobulin Heavy Constant Alpha 2 (A2m marker) | +Inquiry |
B2M-13H | Native Human B2M | +Inquiry |
◆ Cell & Tissue Lysates | ||
DGCR6-467HCL | Recombinant Human DGCR6 cell lysate | +Inquiry |
MAGEA2B-4554HCL | Recombinant Human MAGEA2B 293 Cell Lysate | +Inquiry |
C16orf79-8245HCL | Recombinant Human C16orf79 293 Cell Lysate | +Inquiry |
VPS28-392HCL | Recombinant Human VPS28 293 Cell Lysate | +Inquiry |
SECISBP2-1987HCL | Recombinant Human SECISBP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket