Recombinant Full Length Lemna Minor Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL20578LF |
Product Overview : | Recombinant Full Length Lemna minor Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (A9L9C2) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Lemna Minor |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTITNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP VSPAWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRISAGLAENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAIGWLGHPVFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTKRQAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | A9L9C2 |
◆ Recombinant Proteins | ||
RFL2147BF | Recombinant Full Length Bacillus Weihenstephanensis Lipoprotein Signal Peptidase(Lspa) Protein, His-Tagged | +Inquiry |
MPL-1173C | Recombinant Chicken MPL | +Inquiry |
CD19-0732H | Recombinant Human CD19 Protein, GST-Tagged | +Inquiry |
Arpc1a-1724M | Recombinant Mouse Arpc1a Protein, Myc/DDK-tagged | +Inquiry |
FADS2-6060H | Recombinant Human FADS2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
Lipoproteins-13H | Natve Human Lipoproteins, Very Low Density | +Inquiry |
FDP-X-51H | Native Human Fibrinogen Degrading Product-X | +Inquiry |
APOC3-8040H | Native Human ApoLipoprotein CIII | +Inquiry |
Collagen-318B | Native Bovine Collagen Type IV | +Inquiry |
PLG-15H | Native Human Plasminogen Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HEY1-5575HCL | Recombinant Human HEY1 293 Cell Lysate | +Inquiry |
RAB6C-2584HCL | Recombinant Human RAB6C 293 Cell Lysate | +Inquiry |
CD5-1293RCL | Recombinant Rat CD5 cell lysate | +Inquiry |
NRSN2-3691HCL | Recombinant Human NRSN2 293 Cell Lysate | +Inquiry |
NOXO1-3748HCL | Recombinant Human NOXO1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket