Recombinant Full Length Photorhabdus Luminescens Subsp. Laumondii Macrolide Export Atp-Binding/Permease Protein Macb(Macb) Protein, His-Tagged
Cat.No. : | RFL36570PF |
Product Overview : | Recombinant Full Length Photorhabdus luminescens subsp. laumondii Macrolide export ATP-binding/permease protein MacB(macB) Protein (Q7N6F9) (1-647aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Photorhabdus luminescens |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-647) |
Form : | Lyophilized powder |
AA Sequence : | MNALLELKGIERSYPAGEQQIKVLDDVTLSIYAGEMVAIIGASGSGKSTLMNILGCLDQP SNGEYRVAGQNVAELNNDELAALRREHFGFIFQRYHLLTHLTAEQNVEIPAIYAGAAKAA RRQRAIELLGRLGLEDRIYYQPGQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSG EEVMAILKQLCEQGHTVIIVTHDPKIAAQAQRIIEIKDGHIMSDSGTQVSRKITQTPSLT SKISSIRQIFGRFNEALFMAWRAMVVNKMRTLLTMLGIIIGIASVVTILVIGDAARASVL SDIKEIATNTIDIYPGEDFGIDDPVSKQALKIADADAIKVQPYILAVSPEIEGQMRLRKG NIDVSSKVTGVGDEYFQVYALRFAQGIGFSLDMIRRQGQVVVIDKNTQRKLFPHQKNVIG EVILVGNMPATIVGVIANRESAFGNSKLLHIWLPYSTMTSRLMNRSYLDSITVRVKDDYN SKDAEKMIVQLLTLRHGKKDIFTDNVDMLVKAAEKTAHTLQLFLTMVAVISLIVGGIGVM NIMLVSVTERTREIGIRMAVGARTSDVRQQFLIEAILVCLVGGVLGIGLSYTIAFIAQLA LPGWHFVFQPIALLSAFACSTAIGVIFGFLPARNAARLDPIEALARE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB |
Synonyms | macB; plu1591; Macrolide export ATP-binding/permease protein MacB |
UniProt ID | Q7N6F9 |
◆ Recombinant Proteins | ||
GPR160-1765R | Recombinant Rhesus Macaque GPR160 Protein, His (Fc)-Avi-tagged | +Inquiry |
KLHL8-4866M | Recombinant Mouse KLHL8 Protein, His (Fc)-Avi-tagged | +Inquiry |
SYCN-8906M | Recombinant Mouse SYCN Protein, His (Fc)-Avi-tagged | +Inquiry |
MAPK12A-8980Z | Recombinant Zebrafish MAPK12A | +Inquiry |
CYP2E1-220H | Active Recombinant Human CYP2E1 Protein | +Inquiry |
◆ Native Proteins | ||
C3d-48HB | Native Human Complement C3d Protein, Biotinylated | +Inquiry |
ALB-124P | Native Porcine serum albumin | +Inquiry |
PLG -38C | Native Chicken plasmin | +Inquiry |
LCN2-384H | Native Human LCN2 | +Inquiry |
Batroxobin-99 | Native Bothrops atrox snake venom Batroxobin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ILKAP-1855HCL | Recombinant Human ILKAP cell lysate | +Inquiry |
CENPM-7580HCL | Recombinant Human CENPM 293 Cell Lysate | +Inquiry |
SYT9-1301HCL | Recombinant Human SYT9 293 Cell Lysate | +Inquiry |
OSBPL9-3529HCL | Recombinant Human OSBPL9 293 Cell Lysate | +Inquiry |
TMEM230-8115HCL | Recombinant Human C20orf30 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All macB Products
Required fields are marked with *
My Review for All macB Products
Required fields are marked with *
0
Inquiry Basket