Recombinant Full Length Shigella Boydii Serotype 4 Macrolide Export Atp-Binding/Permease Protein Macb(Macb) Protein, His-Tagged
Cat.No. : | RFL3423SF |
Product Overview : | Recombinant Full Length Shigella boydii serotype 4 Macrolide export ATP-binding/permease protein MacB(macB) Protein (Q323M3) (1-648aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shigella boydii serotype 4 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-648) |
Form : | Lyophilized powder |
AA Sequence : | MTPLLELKDIRRSYPAGDEQVEVLKGITLDIYAGEMVAIVGASGSGKSTLMNILGCLDKA TSGTYRVAGQDVATLDADALAQLRREHFGFIFQRYHLLSHLTAEQNVEVPAVYAGLERKQ RLLRAQELLQRLGLEDRTEYYPAQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSG EEVMAILHQLRDRGHMVIIVTHDPQVAAQAERVIEIRDGEIVRNPPAIEKVNVAGGTEPV VNTVSGWRQFVSGFNEALTMAWRALAANKMRTLLTMLGIIIGIASVVSIVVVGDAAKQMV LADIRSIGTNTIDVYPGKDFGDDDPQYQQALKYDDLIAIQKQPWVASATPAVSQNLRLRY NNVDVAASANGVSGDYFNVYGMTFSEGNTFNQEQLNGRAQVVVLDSNTRRQLFPHKADVV GEVILVGNMPARVIGVAEEKQSMFGSSKVLRVWLPYSTMSGRVMGQSWLNSITVRVKEGF DSAEAEQQLTRLLSLRHGKKDFFTWNMDGVLKTVEKTTRTLQLFLTLVAVISLVVGGIGV MNIMLVSVTERTREIGIRMAVGARASDVLQQFLIEAVLVCLVGGALGITLSLLIAFTLQL FLPGWEIGFSPLALLLAFLCSTATGILFGWLPARNAARLDPVDALVRE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB |
Synonyms | macB; SBO_0812; Macrolide export ATP-binding/permease protein MacB |
UniProt ID | Q323M3 |
◆ Recombinant Proteins | ||
CDK1/CCNE1-1616H | Recombinant Human CDK1/CCNE1 Protein (M1-M297/M1-E410) | +Inquiry |
UBALD1-4445HF | Recombinant Full Length Human UBALD1 Protein, GST-tagged | +Inquiry |
Cct5-805M | Recombinant Mouse Cct5 Protein, MYC/DDK-tagged | +Inquiry |
CCL18-11H | Recombinant Human CCL18 Protein | +Inquiry |
NGRN-28260TH | Recombinant Human NGRN, His-tagged | +Inquiry |
◆ Native Proteins | ||
GGT1-667H | Native Human Gamma-Glutamyl Transferase 1 | +Inquiry |
APOA1-8034H | Native Human ApoLipoprotein | +Inquiry |
SERPINC1-8032H | Native Human Plasma AntiThromblin III | +Inquiry |
RWV-307S | Native Snake RVV-V ACTIVATOR | +Inquiry |
GSN-876P | Active Native Porcine GSN Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABCD1-9149HCL | Recombinant Human ABCD1 293 Cell Lysate | +Inquiry |
UHRF1BP1L-908HCL | Recombinant Human UHRF1BP1L cell lysate | +Inquiry |
HA-1949HCL | Recombinant H1N1 HA cell lysate | +Inquiry |
BNIP1-8425HCL | Recombinant Human BNIP1 293 Cell Lysate | +Inquiry |
ANKS1A-83HCL | Recombinant Human ANKS1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All macB Products
Required fields are marked with *
My Review for All macB Products
Required fields are marked with *
0
Inquiry Basket