Recombinant Full Length Pasteurella Multocida Probable Ubiquinone Biosynthesis Protein Ubib(Ubib) Protein, His-Tagged
Cat.No. : | RFL16532PF |
Product Overview : | Recombinant Full Length Pasteurella multocida Probable ubiquinone biosynthesis protein UbiB(ubiB) Protein (Q9CKD4) (1-527aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pasteurella multocida |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-527) |
Form : | Lyophilized powder |
AA Sequence : | MQIKDISHLYNIIKTFLLYGIDEALPQHRYTRAIRCWRKTLFWLRNQHKDKTFGLRLRLA LQELGPVWIKLGQMLSTRRDLFPPDIADELALLQDQVDPFDGKIARAQIEKALGAPLETW FDEFNETALASASIAQVHTAKFKQNAPHLENRLAGKEVVLKVLRPNIQQMINADLSLMYK VASWIPRIKAEGRRLRPVEVVREYEKNLRDELDLRREMANAIQLRANFENSPMLYIPEMY KQFCHQTVIVMERIYGIPVSNIEELHANGTNMKLLAERGVQVFFTQVFRDSFFHADMHPG NIFVNRAHPDDPQYIGIDCGIVGRLNDHDKRYLAESFVAFFNRDYRRVAEMHVASGWTPK DTNIDDFEQAFREVCEPIFAKPLSEISFGHVLLNLFNVAREYNMEVQPQLVLLQKTLLYI EGLGRQLYPQLDLWDTAKPFLQKWLDEQMGIKAFTKSVKQKLPYWREHLVDLPENVMDAL AQQKIIADELIHLNRTLAKKRNIPHFTSFILGLCTGLAIWLLIYLLS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ubiB |
Synonyms | ubiB; PM1688; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB |
UniProt ID | Q9CKD4 |
◆ Native Proteins | ||
C4A-8392H | Native Human C4A | +Inquiry |
IgY-005C | Native Chicken IgY Ig Fraction | +Inquiry |
Lectin-1845S | Active Native Soybean Agglutinin Protein, Agarose bound | +Inquiry |
calc1-8308S | Native Salmon calc1 | +Inquiry |
ACHE-8345H | Native Human ACHE | +Inquiry |
◆ Cell & Tissue Lysates | ||
PMCH-488HCL | Recombinant Human PMCH lysate | +Inquiry |
IL10RB-1371RCL | Recombinant Rat IL10RB cell lysate | +Inquiry |
AGXT-8967HCL | Recombinant Human AGXT 293 Cell Lysate | +Inquiry |
NR3C1-1218HCL | Recombinant Human NR3C1 cell lysate | +Inquiry |
MFAP1-4353HCL | Recombinant Human MFAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ubiB Products
Required fields are marked with *
My Review for All ubiB Products
Required fields are marked with *
0
Inquiry Basket