Recombinant Full Length Pseudomonas Putida Probable Ubiquinone Biosynthesis Protein Ubib(Ubib) Protein, His-Tagged
Cat.No. : | RFL9287PF |
Product Overview : | Recombinant Full Length Pseudomonas putida Probable ubiquinone biosynthesis protein UbiB(ubiB) Protein (B1J2S6) (1-539aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas Putida |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-539) |
Form : | Lyophilized powder |
AA Sequence : | MKLLAVRRLFRIQRVVIRYRLDDLLFDLPLPWWLRSLRLLMPWRWLPRTPSELSRGARLR LALQDLGPIFIKFGQLLSTRRDLLPTDIADELMLLQDRVPPFDPKQAVALIESQLGAKVG EVFSRFDVEPLASASVAQVHAARLKTGEEVVVKVVRPGLKPVIAQDLAWLFLIAKGAERA SADARRLHPVEIVGDYEKTIYDELDLLREAANASQLRRNFEGSELMYVPQVYWDLCRPKV LVMERIYGVPVTDMATLADQRTDMKLLAERGVEVFFTQVFRHSFFHADMHPGNIFVSTVK PWSPQYIAIDCGIVGSLTAEDQDYLARNLIAFFKRDYRRVAELHIDSGWVPAHTKVNEFE AAIRTVCEPIFEKPLKDISFGQVLMRLFQTARRFNMEVQPQLVLLQKTLLNIEGLGRQLY PDLDLWSTAKPFLERWMRERYSPKAMFGNLYSQAEQLPHLAGMTRDLLERLSQPHLHDPQ LPERRRQGDRWALRLLGAGLLGGGAVLAASAAEAASLAAPAAWPAWLMLAAGLYLIVRQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ubiB |
Synonyms | ubiB; PputW619_0452; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB |
UniProt ID | B1J2S6 |
◆ Recombinant Proteins | ||
SERPING1-280H | Recombinant Human SERPING1 Protein, His-tagged | +Inquiry |
PSMD11A-7602Z | Recombinant Zebrafish PSMD11A | +Inquiry |
GPRASP1-7214M | Recombinant Mouse GPRASP1 Protein | +Inquiry |
HMGB2-4237M | Recombinant Mouse HMGB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CPQ-654H | Recombinant Human CPQ Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
LDH1-16H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
GGT1-8130H | Native Human Liver Gamma-Glutamyltransferase | +Inquiry |
F2-274B | Active Native Bovine α-Thrombin | +Inquiry |
HGF-38P | Native Porcine HGF | +Inquiry |
GG-189S | Native Sheep Gamma Globulin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SAR1B-2063HCL | Recombinant Human SAR1B 293 Cell Lysate | +Inquiry |
RAB40A-2594HCL | Recombinant Human RAB40A 293 Cell Lysate | +Inquiry |
Breast-58H | Human Breast Membrane Tumor Lysate | +Inquiry |
CERK-7567HCL | Recombinant Human CERK 293 Cell Lysate | +Inquiry |
Heart-826M | Mini pig Heart Membrane Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ubiB Products
Required fields are marked with *
My Review for All ubiB Products
Required fields are marked with *
0
Inquiry Basket