Recombinant Full Length Shewanella Sp. Probable Ubiquinone Biosynthesis Protein Ubib(Ubib) Protein, His-Tagged
Cat.No. : | RFL7372SF |
Product Overview : | Recombinant Full Length Shewanella sp. Probable ubiquinone biosynthesis protein UbiB(ubiB) Protein (A0L1M6) (1-549aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shewanella sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-549) |
Form : | Lyophilized powder |
AA Sequence : | MTLASIRRGYHVIKTLLQYGLDDVLPPKMTPWYFKLARNSLFWIRNKHKGKSGGERLKLA MQELGPVYIKLGQMLSTRRDLLSDEWANELAMLQDKVPPFDGALARQAIEAELKAPIESY FDDFDETPLASASISQVHTATLKSNGKAVVLKVLRPNVETKIQADLLLMSQTAKVIDYLL GEGNRLRPSEVIEDYRVTILGELNLKLEALNAIKLRNNFLDSDALYIPYVYEEFCYPRLM VMERIYGIPVSDIAALKAQGTNFKLLAERGVELFFTQVFRDNFFHADMHPGNIFISREHP ENPYYIGLDCGIMGTLSEVDKRYLAENFLAFFNRDYHRIAQLYIESGWVSEKTDLQAFEQ AIKVVCEPMFNKPLDEISFGHVLLELFRTARHFDIVVQPQLVLLEKTLLYIEGLGRQLYP QLDLWQTAKPFLEQWMAEQVGPKAMFKKVSTKLPYWSDKLPEFPELIYDNLKLGRKLLSS QQQMLDKYLKYQQQAHKSNYLLITSAILLICGTLLFNQDATLWSPYVCLISGAVLWIIGW RSRPKNRKF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ubiB |
Synonyms | ubiB; Shewana3_3727; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB |
UniProt ID | A0L1M6 |
◆ Recombinant Proteins | ||
RFL12726TF | Recombinant Full Length Trypanosoma Brucei Brucei Phosphatidylcholine:Ceramide Cholinephosphotransferase 4(Sls4) Protein, His-Tagged | +Inquiry |
EIF2B3-1416R | Recombinant Rhesus monkey EIF2B3 Protein, His-tagged | +Inquiry |
Hspa14-3451M | Recombinant Mouse Hspa14 Protein, Myc/DDK-tagged | +Inquiry |
Hmgb1-293R | Recombinant Rat Hmgb1, Fc-tagged | +Inquiry |
SAOUHSC-01939-1415S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 SAOUHSC_01939 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CPB2-8517H | Active Native Human CPB2 | +Inquiry |
Lectin-1795A | Active Native Artocarpus integrifolia Jacalin Protein | +Inquiry |
FGG -57R | Native Rabbit Fibrinogen, FITC Labeled | +Inquiry |
GGT1-5353H | Native Human Gamma-Glutamyltransferase 1 | +Inquiry |
F9-300R | Native Rat Factor IX | +Inquiry |
◆ Cell & Tissue Lysates | ||
XIAP-263HCL | Recombinant Human XIAP 293 Cell Lysate | +Inquiry |
RSPH10B-2130HCL | Recombinant Human RSPH10B 293 Cell Lysate | +Inquiry |
ARPC2-8685HCL | Recombinant Human ARPC2 293 Cell Lysate | +Inquiry |
Skeletal Muscle-430P | Porcine Skeletal Muscle Lysate | +Inquiry |
ZNF44-2027HCL | Recombinant Human ZNF44 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ubiB Products
Required fields are marked with *
My Review for All ubiB Products
Required fields are marked with *
0
Inquiry Basket