Recombinant Full Length Shewanella Sp. Probable Ubiquinone Biosynthesis Protein Ubib(Ubib) Protein, His-Tagged
Cat.No. : | RFL24494SF |
Product Overview : | Recombinant Full Length Shewanella sp. Probable ubiquinone biosynthesis protein UbiB(ubiB) Protein (Q0HZP9) (1-549aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shewanella sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-549) |
Form : | Lyophilized powder |
AA Sequence : | MTLASIRRGYHVIKTLLQYGLDDVLPPKMTPWYFKLARNSLFWIRNKHKGKSGGERLKLA MQELGPVYIKLGQMLSTRRDLLSDEWANELAMLQDKVPPFDGALARQAIEAELKAPIESF FDDFNETPLASASISQVHTATLKSNGKAVVLKVLRPNVEAKIQADLLLMSQTAKVIDYLL GEGNRLRPSEVIEDYRVTILGELNLKLEALNAIKLRNNFLDSDALYIPYVYEEFCYPRLM VMERIYGIPVSDIAALKAQGTNFKLLAERGVELFFTQVFRDNFFHADMHPGNIFISRDHP ENPYYIGLDCGIMGTLSEVDKRYLAENFLAFFNRDYHRIAQLYIESGWVSEKTDLQAFEQ AIKVVCEPMFNKPLDEISFGHVLLELFRTARHFDIVVQPQLVLLEKTLLYIEGLGRQLYP QLDLWQTAKPFLEQWMAEQVGPKAMFKKVSTKLPYWSDKLPEFPELIYDNLKLGRKLLSS QQQMLDKYLKYQQQAHKSNYLLITSAILLICGTLLFNQDATLWSPYVCLISGAALWIIGW RSRPKNRKF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ubiB |
Synonyms | ubiB; Shewmr7_0403; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB |
UniProt ID | Q0HZP9 |
◆ Native Proteins | ||
E2-01H | Native Human Estradiol (E2) | +Inquiry |
BPE-138 | Native Red algae B-Phycoerythrin protein | +Inquiry |
APOA1-256H | Native Human APOA1 protein | +Inquiry |
Fxa-282B | Active Native Bovine Factor Xa - EGR | +Inquiry |
Prothrombin-270B | Active Native Bovine Prothrombin | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMC4-2760HCL | Recombinant Human PSMC4 293 Cell Lysate | +Inquiry |
CPB-134R | Rabbit Anti-RSVgp07 Polyclonal Antibody | +Inquiry |
Liver-297H | Human Liver Membrane Lysate | +Inquiry |
STRADA-1041HCL | Recombinant Human STRADA cell lysate | +Inquiry |
MRPL43-4164HCL | Recombinant Human MRPL43 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ubiB Products
Required fields are marked with *
My Review for All ubiB Products
Required fields are marked with *
0
Inquiry Basket