Recombinant Full Length Panax Ginseng Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL18620PF |
Product Overview : | Recombinant Full Length Panax ginseng Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (Q68RY1) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Panax ginseng (Korean ginseng) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSVTGGAIPNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFSDERTGKPSLDLPKIFGIHLFLAGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQS VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTRRQVV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; PSC0743; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | Q68RY1 |
◆ Native Proteins | ||
Annexin-013 | Native Annexin Protein, Gold conjugated | +Inquiry |
REN -16H | Recombinant Human Prorenin, His-tagged | +Inquiry |
GOT1-5351H | Native Human Glutamic-Oxaloacetic Transaminase 1, Soluble (aspartate aminotransferase 1) | +Inquiry |
IgG-334D | Native Donkey IgG | +Inquiry |
IgG-335G | Native GOAT Gamma Globulin Fraction | +Inquiry |
◆ Cell & Tissue Lysates | ||
HUS1B-5326HCL | Recombinant Human HUS1B 293 Cell Lysate | +Inquiry |
POLR3D-3025HCL | Recombinant Human POLR3D 293 Cell Lysate | +Inquiry |
CNTNAP1-7390HCL | Recombinant Human CNTNAP1 293 Cell Lysate | +Inquiry |
WDFY2-1922HCL | Recombinant Human WDFY2 cell lysate | +Inquiry |
NDUFAF2-436HCL | Recombinant Human NDUFAF2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket