Recombinant Full Length Panax Ginseng Nad(P)H-Quinone Oxidoreductase Subunit 1, Chloroplastic(Ndha) Protein, His-Tagged
Cat.No. : | RFL18246PF |
Product Overview : | Recombinant Full Length Panax ginseng NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic(ndhA) Protein (Q68RV1) (1-363aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Panax ginseng (Korean ginseng) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-363) |
Form : | Lyophilized powder |
AA Sequence : | MIIDTTEVQAINSFFRLESLKEVYGIIWMLIPIFTPVLGITIGVLVIVWLEREISAGIQQ RIGPEYAGPLGILQALADGTKLLFKENLLPSRGDTRLFSIGPSVAVTSILLSYLVIPFGY HLVLADLSIGVFLWIAISSIAPVGLLMSGYGSNNKYSFLGGLRAAAQSISYEIPLTLCVL SISLLSNSSSTVDIVEAQSKYGFWGWNLWRQPIGFIIFLISSLAECERLPFDLPEAEEEL VAGYQTEYSGIKFGLFYVASYLNLLVSSLFVTVLYLGGWNLSIPYIPVPDIFEINKASRV FGTITGIFITLAKTYLFLFIPITTRWTLPRLRMDQLLNLGWKFLLPISLGNLLLTTSSQL LSL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ndhA |
Synonyms | ndhA; PSC1220; NAD(PH-quinone oxidoreductase subunit 1, chloroplastic; NAD(PH dehydrogenase subunit 1; NDH subunit 1; NADH-plastoquinone oxidoreductase subunit 1 |
UniProt ID | Q68RV1 |
◆ Recombinant Proteins | ||
Fcgr2b-2968M | Active Recombinant Mouse Fcgr2b protein(Met1-Arg217), His&Avi-tagged, Biotinylated | +Inquiry |
Bst1-7490R | Recombinant Rat Bst1 protein, hFc-tagged | +Inquiry |
STMN1-5455R | Recombinant Rat STMN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PRKCH-301284H | Recombinant Human PRKCH protein, GST-tagged | +Inquiry |
MAP4-4494H | Recombinant Human MAP4 Protein (Lys906-Glu1089), N-His tagged | +Inquiry |
◆ Native Proteins | ||
F5-1176H | Native Human Coagulation Factor V, FITC conjugated | +Inquiry |
APOH-5365H | Native Human Apolipoprotein H (beta-2-glycoprotein I) | +Inquiry |
Pectin-008A | Native Apple or Citrus fruits Pectin | +Inquiry |
Annexin-V-009H | Native Human Annexin-V Protein | +Inquiry |
LTF-27590TH | Native Human LTF | +Inquiry |
◆ Cell & Tissue Lysates | ||
HS6ST2-5383HCL | Recombinant Human HS6ST2 293 Cell Lysate | +Inquiry |
PPP1CA-2953HCL | Recombinant Human PPP1CA 293 Cell Lysate | +Inquiry |
GKN1-001HCL | Recombinant Human GKN1 cell lysate | +Inquiry |
KRT15-4879HCL | Recombinant Human KRT15 293 Cell Lysate | +Inquiry |
ZNF16-139HCL | Recombinant Human ZNF16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ndhA Products
Required fields are marked with *
My Review for All ndhA Products
Required fields are marked with *
0
Inquiry Basket