Recombinant Human PRKCH protein, GST-tagged
Cat.No. : | PRKCH-301284H |
Product Overview : | Recombinant Human PRKCH (634-683 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Arg634-Pro683 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | RIKSREDVSNFDPDFIKEEPVLTPIDEGHLPMINQDEFRNFSYVSPELQP |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | PRKCH protein kinase C, eta [ Homo sapiens ] |
Official Symbol | PRKCH |
Synonyms | PRKCH; protein kinase C, eta; PRKCL; protein kinase C eta type; PKC L; PKCL; PKC-L; nPKC-eta; MGC5363; MGC26269; |
Gene ID | 5583 |
mRNA Refseq | NM_006255 |
Protein Refseq | NP_006246 |
MIM | 605437 |
UniProt ID | P24723 |
◆ Recombinant Proteins | ||
PRKCH-1440HF | Active Recombinant Full Length Human PRKCH Protein, DDK-tagged, Biotinylated | +Inquiry |
PRKCH-301284H | Recombinant Human PRKCH protein, GST-tagged | +Inquiry |
PRKCH-13367M | Recombinant Mouse PRKCH Protein | +Inquiry |
PRKCH-28938TH | Recombinant Human PRKCH | +Inquiry |
PRKCH-18H | Recombinant Human PRKCH protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRKCH-2855HCL | Recombinant Human PRKCH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRKCH Products
Required fields are marked with *
My Review for All PRKCH Products
Required fields are marked with *
0
Inquiry Basket