Recombinant Full Length Panax Ginseng Casp-Like Protein 1 Protein, His-Tagged
Cat.No. : | RFL12589PF |
Product Overview : | Recombinant Full Length Panax ginseng CASP-like protein 1 Protein (Q20BM9) (1-148aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Panax ginseng (Korean ginseng) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-148) |
Form : | Lyophilized powder |
AA Sequence : | MVTGKQTELIPIPFPPYQIPYSSKFTDSPAFIYFVAAFSVAGLYSIITSLLSGLALLKPG YAKQLVSHFVVVDVLLLGIVAAAIGAAGGVGYIGLRGNSHSRWTKICNIYDTFCQHLAGS IAAGLIASIVLVLLILLSFFTLSRKIPK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Panax ginseng CASP-like protein 1 |
Synonyms | CASP-like protein 1 |
UniProt ID | Q20BM9 |
◆ Native Proteins | ||
IgG-354G | Native Guinea Pig IgG | +Inquiry |
Lectin-1808M | Active Native Maackia Amurensis Lectin I Protein, Fluorescein labeled | +Inquiry |
SAP6-91 | Active Native Saponaria Officinalis SAP6 | +Inquiry |
RV-11 | Native Rubella Virus Antigen | +Inquiry |
EGF-23H | Active Native Human EGF protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRIM8-1837HCL | Recombinant Human TRIM8 cell lysate | +Inquiry |
PAX3-3418HCL | Recombinant Human PAX3 293 Cell Lysate | +Inquiry |
POLR3H-3021HCL | Recombinant Human POLR3H 293 Cell Lysate | +Inquiry |
NUPL2-3625HCL | Recombinant Human NUPL2 293 Cell Lysate | +Inquiry |
SLC6A4-1638HCL | Recombinant Human SLC6A4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Panax ginseng CASP-like protein 1 Products
Required fields are marked with *
My Review for All Panax ginseng CASP-like protein 1 Products
Required fields are marked with *
0
Inquiry Basket