Recombinant Full Length Micropogonias Undulatus Gap Junction Cx32.7 Protein Protein, His-Tagged
Cat.No. : | RFL1708MF |
Product Overview : | Recombinant Full Length Micropogonias undulatus Gap junction Cx32.7 protein Protein (P51916) (2-282aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Micropogonias undulatus (Atlantic croaker) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-282) |
Form : | Lyophilized powder |
AA Sequence : | GEWDLLGRLLDKVQSHSTVIGKVWLTVLFVFRILVLRTGADRVWGDEQSDFVCNTQQPGC ENVCYDLAFPISHVRFWFLQIIAVATPKLLYLGHVLHVIHAEKKMKERMKKQAELDDQTN LFLRKAYKVPKYTKSSGKISIRGRLLRSYVYHLVAKIILEVLFIVGQYFLYGFTLDTRYV CTRFPCPHKVDCFLSRPTEKSVIIWFMLVAAFVSLFLSLVELFYLCVKAAKECMARRQDY TVTPVTPPLLARKSFKSHKEVFQNCVNEPASPENNMEEVHI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Micropogonias undulatus Gap junction Cx32.7 protein |
Synonyms | Gap junction Cx32.7 protein; Connexin-32.7 |
UniProt ID | P51916 |
◆ Native Proteins | ||
H3N20799-215I | Native H3N2 (A/Panama/2007/99) H3N20799 protein | +Inquiry |
pepsin -174P | Native Pig pepsin(1:3000) active | +Inquiry |
A1m-367M | Native Mouse A1m | +Inquiry |
Tropomyosin-894R | Native Rabbit Tropomyosin Protein | +Inquiry |
FGA-78H | Active Native Human Fibrinogen (Pg & vWF depleted) | +Inquiry |
◆ Cell & Tissue Lysates | ||
IgG2-1610HCL | Recombinant Human IgG2 cell lysate | +Inquiry |
ARL2-8716HCL | Recombinant Human ARL2 293 Cell Lysate | +Inquiry |
MYCBP-4038HCL | Recombinant Human MYCBP 293 Cell Lysate | +Inquiry |
CNOT2-7403HCL | Recombinant Human CNOT2 293 Cell Lysate | +Inquiry |
TBX22-1200HCL | Recombinant Human TBX22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Micropogonias undulatus Gap junction Cx32.7 protein Products
Required fields are marked with *
My Review for All Micropogonias undulatus Gap junction Cx32.7 protein Products
Required fields are marked with *
0
Inquiry Basket