Recombinant Full Length Oryza Sativa Subsp. Japonica 3-Hydroxy-3-Methylglutaryl-Coenzyme A Reductase 1(Hmg1) Protein, His-Tagged
Cat.No. : | RFL22858OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. japonica 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1(HMG1) Protein (Q0DY59) (1-532aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-532) |
Form : | Lyophilized powder |
AA Sequence : | MDVRRGGGGGRIVGAARRALTWGALPLPMRITNGLAMVSLVLSSCDLLRLCSDRERPLGG REFATVVYLVSLFAHPDAPATTTGDDDDGQGGSRRARPAAAEPAPMHGHGGGMMEADDEE IVAAVASGALPSHRLESRLGDCRRAARLRREALRRVTGRGVEGLPFDGMDYQAILGQCCE MPVGYVQLPVGVAGPLLLDGREYHVPMATTEGCLVASVNRGCRAISASGGAFSVLLRDAM SRAPAVKLPSAMRAAELKAFAEAPANFELLAAVFNRSSRFGRLQDIRCALAGRNLYMRFS CITGDAMGMNMVSKGVENVLGYLQNVFPDMDVISVSGNYCSDKKPTAVNWIEGRGKSVVC EAIIKGDVVQKVLKTTVEKLVELNIIKNLAGSAVAGALGGFNAHASNIVTALFIATGQDP AQNVESSQCITMLEEVNDGDDLHISVTMPSIEVGTIGGGTCLASQAACLNLLGVKGSNHG SPGANAKRLATIVAGSVLAGELSLLAALASGHLVKSHMMYNRSSKDVAKAAS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HMG1 |
Synonyms | HMG1; Os02g0713900; LOC_Os02g48330; 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1; HMG-CoA reductase 1 |
UniProt ID | Q0DY59 |
◆ Recombinant Proteins | ||
CDH11-0972H | Recombinant Human CDH11 Protein, GST-Tagged | +Inquiry |
TNFAIP8-5277H | Recombinant Human TNFAIP8 protein, GST-tagged | +Inquiry |
HPD-0404H | Recombinant Human HPD Protein (Met1-Met393), N-His-tagged | +Inquiry |
RFL32015BF | Recombinant Full Length Bovine Coronavirus Hemagglutinin-Esterase(He) Protein, His-Tagged | +Inquiry |
AMELY-9613H | Recombinant Human AMELY, GST-tagged | +Inquiry |
◆ Native Proteins | ||
S100A11-3111H | Native Human S100A11 protein(Met1-Thr105) | +Inquiry |
Proteasome 20S-37H | Native Human Proteasome 20S Protein, Tag Free | +Inquiry |
FN1-3B | Active Bovine Fibronectin, carrier free | +Inquiry |
IgG-329R | Native Rabbit Gamma Globulin Fraction | +Inquiry |
Collagen-326H | Native Human Collagen Type III | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCNH2-5059HCL | Recombinant Human KCNH2 293 Cell Lysate | +Inquiry |
CHGB-348HCL | Recombinant Human CHGB cell lysate | +Inquiry |
GPC6-5811HCL | Recombinant Human GPC6 293 Cell Lysate | +Inquiry |
OGFR-455HCL | Recombinant Human OGFR lysate | +Inquiry |
Skin-759B | Bovine Skin Membrane Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HMG1 Products
Required fields are marked with *
My Review for All HMG1 Products
Required fields are marked with *
0
Inquiry Basket