Recombinant Full Length Bovine Coronavirus Hemagglutinin-Esterase(He) Protein, His-Tagged
Cat.No. : | RFL32015BF |
Product Overview : | Recombinant Full Length Bovine coronavirus Hemagglutinin-esterase(HE) Protein (Q8V437) (19-424aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | BtCoV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (19-424) |
Form : | Lyophilized powder |
AA Sequence : | FDNPPTNVVSHLNGDWFLFGDSRSDCNHVVTTNPRNYSYMDLNPALCGSGKISAKAGNSI FRSFHFTDFYNYTGEGQQIIFYEGVNFTPYHAFKCITSGSNDIWMQNKGLFYTQVYKNMA VYRSLTFVNVPYVYNGSAQSTALCKSGSLVLNNPAYIAREANFGDYYYKVEADFYLSGCD EYIVPLCIFNGKFLSNTKYYDDSQYYFNKDTGVIYGLNSTETITTGFDFNCHYLVLPSGN YLAISNELLLTVPTKAICLNKRKDFTPVQVVDSRWNNARQSDNMTAVACQPPYCYFRNST TNYVGVYDINHGDAGFTSILSGLLYDSPCFSQQGVFRYDNVSSVWPLYPYGRCPTAADIN TPDVPICVYDPLPIILLGILLGVAVIIIVVLLLYFMVDNGTRLHDA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HE |
Synonyms | HE; 2b; Hemagglutinin-esterase; HE protein; E3 glycoprotein |
UniProt ID | Q8V437 |
◆ Recombinant Proteins | ||
MARCH9-2502R | Recombinant Rhesus Macaque MARCH9 Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPS9-4361Z | Recombinant Zebrafish MRPS9 | +Inquiry |
APOB-2095P | Recombinant Pig APOB protein, His & GST-tagged | +Inquiry |
CYP39A1-982R | Recombinant Rhesus Macaque CYP39A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GPR15-5643HF | Recombinant Full Length Human GPR15 Protein | +Inquiry |
◆ Native Proteins | ||
SUMO Protease-01 | Native purified SUMO Protease, N-His-tagged | +Inquiry |
GG-182B | Native Bovine Gamma Globulin | +Inquiry |
MMP8-89H | Native Human Pro-MMP-8 | +Inquiry |
ALB-7995H | Native Human Serum Albumin(Protease Free) | +Inquiry |
Proteoglycans-53H | Native Human Proteoglycans | +Inquiry |
◆ Cell & Tissue Lysates | ||
BAP1-8515HCL | Recombinant Human BAP1 293 Cell Lysate | +Inquiry |
TMEM61-690HCL | Recombinant Human TMEM61 lysate | +Inquiry |
HLA-DPB1-5505HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
SOD2-1574HCL | Recombinant Human SOD2 293 Cell Lysate | +Inquiry |
CRTAP-7272HCL | Recombinant Human CRTAP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HE Products
Required fields are marked with *
My Review for All HE Products
Required fields are marked with *
0
Inquiry Basket