Recombinant Human CDH11 Protein, GST-Tagged

• Cat.No.: CDH11-0972H
• Product Overview: Human CDH11 partial ORF (NP_001788, 509 a.a. - 617 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a type II classical cadherin from the cadherin superfamily, integral membrane proteins that mediate calcium-dependent cell-cell adhesion. Mature cadherin proteins are composed of a large N-terminal extracellular domain, a single membrane-spanning domain, and a small, highly conserved C-terminal cytoplasmic domain. Type II (atypical) cadherins are defined based on their lack of a HAV cell adhesion recognition sequence specific to type I cadherins. Expression of this particular cadherin in osteoblastic cell lines, and its upregulation during differentiation, suggests a specific function in bone development and maintenance. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 37.73 kDa
• AA Sequence: PIVTISADDKDDTANGPRFIFSLPPEIIHNPNFTVRDNRDNTAGVYARRGGFSRQKQDLYLLPIVISDGGIPPMSSTNTLTIKVCGCDVNGALLSCNAEAYILNAGLST
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDH11 cadherin 11, type 2, OB-cadherin (osteoblast) [ Homo sapiens ]
• Official Symbol: CDH11
• Synonyms: CDH11; cadherin 11, type 2, OB-cadherin (osteoblast); cadherin-11; CAD11; OB; OB Cadherin; CDHOB; OSF-4
• Gene ID: 1009
• mRNA Refseq: NM_001797
• Protein Refseq: NP_001788
• MIM: 600023
• UniProt ID: P55287