Recombinant Human CDH11 Protein, GST-Tagged

Cat.No. : CDH11-0972H
Product Overview : Human CDH11 partial ORF (NP_001788, 509 a.a. - 617 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a type II classical cadherin from the cadherin superfamily, integral membrane proteins that mediate calcium-dependent cell-cell adhesion. Mature cadherin proteins are composed of a large N-terminal extracellular domain, a single membrane-spanning domain, and a small, highly conserved C-terminal cytoplasmic domain. Type II (atypical) cadherins are defined based on their lack of a HAV cell adhesion recognition sequence specific to type I cadherins. Expression of this particular cadherin in osteoblastic cell lines, and its upregulation during differentiation, suggests a specific function in bone development and maintenance. [provided by RefSeq, Jul 2008]
Molecular Mass : 37.73 kDa
AA Sequence : PIVTISADDKDDTANGPRFIFSLPPEIIHNPNFTVRDNRDNTAGVYARRGGFSRQKQDLYLLPIVISDGGIPPMSSTNTLTIKVCGCDVNGALLSCNAEAYILNAGLST
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDH11 cadherin 11, type 2, OB-cadherin (osteoblast) [ Homo sapiens ]
Official Symbol CDH11
Synonyms CDH11; cadherin 11, type 2, OB-cadherin (osteoblast); cadherin-11; CAD11; OB; OB Cadherin; CDHOB; OSF-4;
Gene ID 1009
mRNA Refseq NM_001797
Protein Refseq NP_001788
MIM 600023
UniProt ID P55287

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CDH11 Products

Required fields are marked with *

My Review for All CDH11 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon