Recombinant Full Length Orgyia Pseudotsugata Multicapsid Polyhedrosis Virus Occlusion-Derived Virus Envelope Protein E56(Odvp6E) Protein, His-Tagged
Cat.No. : | RFL36102OF |
Product Overview : | Recombinant Full Length Orgyia pseudotsugata multicapsid polyhedrosis virus Occlusion-derived virus envelope protein E56(ODVP6E) Protein (Q83953) (1-374aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Orgyia pseudotsugata multicapsid polyhedrosis virus (OpMNPV) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-374) |
Form : | Lyophilized powder |
AA Sequence : | MSFFTNLRRVNKVYPDSASFIVDNRLLLNTTPAGFTNVLNVPSTRNLGNGRFEPGYNLSN NQFVSAGDINRITRSNDVPRIRGVFQGISDPQIGSLNQLRRVDNVPDANLHVKRTRGDAV KQSFPETNVRSAEGVDRALQQNPRLNTYLQGAKAAGVGVLLAGGAYLTFSAATLVQDIIR ALNNTGGSYYVRGSDGGETADACLLLHRTCQRDPNMNTSEVAICANDPLVSNTAQLQAIC SGFNYEQEQTVCRQSDPAADPDSPQFVDVSDLLPGQTIMCIEPYSLGDLIGDLGLDHLLG EEGLVGKSSNSSDSVSNKLMPLIWLIGAVLFLALVVYLIYRFLIKGGGSSTTNAPPVVIV PPPATTNLNPQQQI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ODVP6E |
Synonyms | ODVP6E; ORF146; Occlusion-derived virus envelope protein E56; ODV-E56; ODVP-6E |
UniProt ID | Q83953 |
◆ Native Proteins | ||
CALM3-74B | Native Bovine Calmodulin | +Inquiry |
Lectin-1803L | Active Native Lycopersicon Esculentum Lectin Protein, DyLight 594 labeled | +Inquiry |
REN-388H | Active Native Human Renin Antigen | +Inquiry |
COL3A1-17B | Native Bovine COL3A1 Protein | +Inquiry |
CDA002 | Active Native Human MUC16 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALKBH8-18HCL | Recombinant Human ALKBH8 lysate | +Inquiry |
Kidney-101M | Mouse Kidney Tissue Lysate (7 Days Old) | +Inquiry |
CDH6-2727HCL | Recombinant Human CDH6 cell lysate | +Inquiry |
CLK3-697HCL | Recombinant Human CLK3 cell lysate | +Inquiry |
MPV17L2-4220HCL | Recombinant Human MPV17L2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ODVP6E Products
Required fields are marked with *
My Review for All ODVP6E Products
Required fields are marked with *
0
Inquiry Basket