Recombinant Full Length Saccharum Officinarum Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL18434SF |
Product Overview : | Recombinant Full Length Saccharum officinarum Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (Q6ENT8) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Saccharum Officinarum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLLSVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSISGGTVTNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLAGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQA VNPAWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSDGLAENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRDKEGRELFVRRMP TFFETFPVVLVDEEGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHATFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGTFQKVGDPTTRRQAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | Q6ENT8 |
◆ Recombinant Proteins | ||
Ubiquitin-11HFL | Recombinant Full Length Human Ubiquitin Protein, HA tagged, Vinyl Pentyl Sulfone Labeled | +Inquiry |
DTL-2544M | Recombinant Mouse DTL Protein, His (Fc)-Avi-tagged | +Inquiry |
VPS37C-3902H | Recombinant Human VPS37C protein, His-tagged | +Inquiry |
DDR1-1034R | Recombinant Rhesus Macaque DDR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
YFMC-1971B | Recombinant Bacillus subtilis YFMC protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Acta1-158M | Native Mouse skeletal muscle alpha Actin | +Inquiry |
CP-5326H | Native Human Ceruloplasmin (ferroxidase) | +Inquiry |
H3N20799-215I | Native H3N2 (A/Panama/2007/99) H3N20799 protein | +Inquiry |
Fga-299M | Active Native Mouse Fibrinogen | +Inquiry |
TIMP1-92H | Native Human TIMP-1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPH3AL-2232HCL | Recombinant Human RPH3AL 293 Cell Lysate | +Inquiry |
Pancreas-364H | Human Pancreas Membrane Diabetic Disease Lysate | +Inquiry |
DKC1-6916HCL | Recombinant Human DKC1 293 Cell Lysate | +Inquiry |
EPHA4-1192CCL | Recombinant Cynomolgus EPHA4 cell lysate | +Inquiry |
IL16-5245HCL | Recombinant Human IL16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket