Recombinant Full Length Oenothera Biennis Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL1842OF |
Product Overview : | Recombinant Full Length Oenothera biennis Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (B0Z4Y6) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Oenothera biennis (German evening primrose) (Onagra biennis) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLLAVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTVTNPGIWSYEGVAGSHILFSGLCFLAAIWHWVYWDL AIFSDERTGKPSLDLPKIFGIHLFLSGLACFGFGAFHVTGLYGPGIWVSDPYGLTGEVQP VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVGAGLAKNQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDSGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTIEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDTQVEFGAFQKLGDPTTRRQAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | B0Z4Y6 |
◆ Recombinant Proteins | ||
RASGRF2-4595R | Recombinant Rat RASGRF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Gdf11-282M | Recombinant Mouse Gdf11 Protein, His-tagged | +Inquiry |
SAT2-2144HFL | Recombinant Full Length Human SAT2 Protein, C-Flag-tagged | +Inquiry |
REXO2-4662R | Recombinant Rat REXO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
FGF19-251H | Recombinant Human FGF19, FLAG-tagged | +Inquiry |
◆ Native Proteins | ||
ALB-311H | Native Human Albumin, Texas Red Label | +Inquiry |
GOT-186S | Active Native Porcine Glutamate Oxaloacetate Tranasminase | +Inquiry |
Collagen-225B | Native Bovine Type IV Collagen Protein | +Inquiry |
GPT-187H | Active Native Human Glutamate Pyruvate Transaminase | +Inquiry |
Lectin-1815P | Active Native Peanut Lectin Protein, Cy5 labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRA2B-827HCL | Recombinant Human TRA2B 293 Cell Lysate | +Inquiry |
FAM129A-6431HCL | Recombinant Human FAM129A 293 Cell Lysate | +Inquiry |
Fetal Prostate -157H | Human Fetal Prostate Lysate | +Inquiry |
C17orf66-8232HCL | Recombinant Human C17orf66 293 Cell Lysate | +Inquiry |
SLC25A23-1623HCL | Recombinant Human SLC25A23 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket