Recombinant Full Length Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL35018OF |
Product Overview : | Recombinant Full Length Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (Q0P3P8) (1-454aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ostreococcus tauri |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-454) |
Form : | Lyophilized powder |
AA Sequence : | MWRQGMFVLPFMTRLGVTNSWGGWTISGESTSNPGLWSYEGVAASHIILSGLLFLAAIWH WVFWDLELFRDPRTQQPALDLPKIFGIHLFLSGVLCFGFGAFHVTGLFGPGIWVSDPYGL TGAVEPVAPAWGAEGFDPYNPGGIAAHHIAAGIVGILAGLFHLSVRPPQRLYKALRMGNV ETVLSSSIAAVFWAAFVVGGTMWYGCAATPIELFGPTRYQWDQGFFQQEIEKRVQTSVAG GASLSTAWSTIPEKLAFYDYIGNNPAKGGLFRSGPMDNGDGIAAGWLGHATFTDKNGREL FVRRMPTFFETFPVILIDGDGVVRADVPFRRAESKYSIEQVGVNVTFYGGELDGLTFTDP ATVKKYARRAQLGEVFEFDRATLQSDGVFRSSPRAWFTFAHVSFALLFFFGHIWHGARTI FRDVFAGIDPDLDEQVEFGAFQKLGDVTTRRQAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; OtCpg00040; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | Q0P3P8 |
◆ Native Proteins | ||
Collagen Type I-61H | Native Human Collagen Type I/III | +Inquiry |
Fibrinogen-71R | Active Native Rabbit Fibrinogen | +Inquiry |
BGLAP-286B | Native Bovine Osteocalcin | +Inquiry |
CED026 | Active Bovine Superoxide Dismutase (SOD), High Purity >95% | +Inquiry |
Luciferase-09F | Active Native Firefly Luciferase | +Inquiry |
◆ Cell & Tissue Lysates | ||
WFIKKN2-2104HCL | Recombinant Human WFIKKN2 cell lysate | +Inquiry |
UBXN1-541HCL | Recombinant Human UBXN1 293 Cell Lysate | +Inquiry |
ZNF155-140HCL | Recombinant Human ZNF155 293 Cell Lysate | +Inquiry |
Pituitary-542E | Equine Pituitary Lysate, Total Protein | +Inquiry |
MUM1-1156HCL | Recombinant Human MUM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket