Recombinant Full Length Oceanobacillus Iheyensis Cardiolipin Synthase(Cls) Protein, His-Tagged
Cat.No. : | RFL14129OF |
Product Overview : | Recombinant Full Length Oceanobacillus iheyensis Cardiolipin synthase(cls) Protein (Q8EM16) (1-479aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Oceanobacillus iheyensis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-479) |
Form : | Lyophilized powder |
AA Sequence : | MGITSLLLGLTFVLNIALAISIIFLERKDPTSSWAWVMVLLFIPILGFFLYLIFGKPISN RKIFSWDKKSRLGVKTTVQSQLRLLEENQFEFNQPDLIEHKDLVYLHLKNDEAIYTQNNG VDIFTDGQTKFDALLEDIEKAKKHIHIQYYIMRSDGLGNRLADMLIKKVNEGVEVRVLYD DMGSRSLKNSYIKRLKRAGVMVEAFFPSRFIVNFKINYRNHRKLAIIDGYIGYLGGFNVG DEYLGINKKFGYWRDTHLRVIGDAVQSMQTRFILDWNQASRDTILYNEDYYQTVSAGNVG MQIVTSGPDSEYEQIKNGYIKMIMEANDYICIQTPYFIPDESLRDALKIAVLSGVHVKIM IPNKPDHPFVYWATLSYCGDLIQAGAEIFIYQNGFLHAKTIIVDGRIASVGTANIDVRSF RLNFEVNGFLYDSEVVNRLQNEFDADLEKSTQMTRKLYDQRSIGIRFKESISRLISPVL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cls |
Synonyms | cls; OB3045; Cardiolipin synthase; CL synthase |
UniProt ID | Q8EM16 |
◆ Recombinant Proteins | ||
CREBBP-19H | Recombinant Human CREBBP Protein, GST-tagged | +Inquiry |
KCNJ1A.1-11267Z | Recombinant Zebrafish KCNJ1A.1 | +Inquiry |
KCNK10-2362R | Recombinant Rhesus monkey KCNK10 Protein, His-tagged | +Inquiry |
PRL-229R | Recombinant Rat Prolactin / PRL Protein, Monomer | +Inquiry |
N-246H | Recombinant HCoV-HKU1 N Protein, His-tagged(C-ter) | +Inquiry |
◆ Native Proteins | ||
Lectin-1816P | Active Native Peanut Lectin Protein, Fluorescein labeled | +Inquiry |
SERPINA1-5358H | Native Human Serpin Peptidase Inhibitor, Clade A (alpha-1 antiproteinase, antitrypsin), Member 1 | +Inquiry |
CDA007 | Native Human Cancer Antigen 72-4 | +Inquiry |
IgA-3882M | Native Monkey Immunoglobulin A, Tag Free | +Inquiry |
Lectin-1777G | Active Native Galanthus Nivalis Lectin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF4ENIF1-544HCL | Recombinant Human EIF4ENIF1 cell lysate | +Inquiry |
SHMT1-1855HCL | Recombinant Human SHMT1 293 Cell Lysate | +Inquiry |
LCN15-4800HCL | Recombinant Human LCN15 293 Cell Lysate | +Inquiry |
GRM8-5731HCL | Recombinant Human GRM8 293 Cell Lysate | +Inquiry |
CAPRIN1-7857HCL | Recombinant Human CAPRIN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cls Products
Required fields are marked with *
My Review for All cls Products
Required fields are marked with *
0
Inquiry Basket