Recombinant Full Length Nymphaea Alba Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL17284NF |
Product Overview : | Recombinant Full Length Nymphaea alba Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (Q6EW26) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Nymphaea alba (White water-lily) (Castalia alba) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLLSVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTVTNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP VNPSWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKALRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVNAGLAENLSLSE SWSKIPDKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRDKEGHELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELDGVSYNDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTRRQVV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | Q6EW26 |
◆ Recombinant Proteins | ||
TMEFF2-5780H | Recombinant Human TMEFF2 Protein (Thr52-Arg290), N-His tagged | +Inquiry |
PDE6H-11046Z | Recombinant Zebrafish PDE6H | +Inquiry |
RFL27031CF | Recombinant Full Length Clostridium Thermocellum Upf0365 Protein Cthe_0858 (Cthe_0858) Protein, His-Tagged | +Inquiry |
ACVR1B-287H | Recombinant Human ACVR1B Protein, His-tagged | +Inquiry |
DNPH1-1626H | Recombinant Human DNPH1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
Avidin-155C | Active Native Chicken Egg White Avidin | +Inquiry |
ApoC-III-3559H | Native Human ApoC-III | +Inquiry |
A35R-01M | Native Monkeypox virus A35R protein | +Inquiry |
Copper containing Amine oxidase-004B | Active Native Bovine Copper containing Amine oxidase Protein | +Inquiry |
a-Macroglobulin-535H | Active Native Human a-Macroglobulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF69-27HCL | Recombinant Human ZNF69 293 Cell Lysate | +Inquiry |
SOCS5-1578HCL | Recombinant Human SOCS5 293 Cell Lysate | +Inquiry |
MXD3-4047HCL | Recombinant Human MXD3 293 Cell Lysate | +Inquiry |
FCGRT & B2M-1534CCL | Recombinant Cynomolgus FCGRT & B2M cell lysate | +Inquiry |
PVR-2996MCL | Recombinant Mouse PVR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket