Recombinant Full Length Lolium Perenne Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL27303LF |
Product Overview : | Recombinant Full Length Lolium perenne Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (A8Y9B2) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Lolium perenne |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLLAVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITDSWGGWSISGGTVTNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL AIFSDDRTGKPSLDLPKIFGIHLFLAGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQA VNPAWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSNGLAENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRDKEGRELFVRRMP TFFETFPVVLVDEEGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRSQLGEIFELDRATLKSDGVFRSSPRGWFTFGHATFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGTFQKVGDPTTRKQAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; LopeCp067; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | A8Y9B2 |
◆ Recombinant Proteins | ||
RFL30138XF | Recombinant Full Length Xenopus Laevis Transmembrane Protein 129(Tmem129) Protein, His-Tagged | +Inquiry |
S100A9-3733H | Recombinant Full Length Human S100A9, His-tagged | +Inquiry |
ZPBP2-5245H | Recombinant Human ZPBP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PAK2-4796H | Recombinant Human PAK2 Protein (Glu177-Ala419), His tagged | +Inquiry |
CTGF-1313R | Recombinant Rat CTGF Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
RO60-16C | Native Cattle RO60 Protein, Biotinlyated | +Inquiry |
Lectin-1762A | Active Native Agaricus bisporus lectin Protein, Biotinylated | +Inquiry |
AVD-3786C | Native Chicken AVD | +Inquiry |
CA242-161H | Active Native Human Cancer Antigen 242 | +Inquiry |
APOB-8037H | Native Human Plasma APOB | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNF41-2274HCL | Recombinant Human RNF41 293 Cell Lysate | +Inquiry |
SLCO1A2-1691HCL | Recombinant Human SLCO1A2 293 Cell Lysate | +Inquiry |
AIFM1-8954HCL | Recombinant Human AIFM1 293 Cell Lysate | +Inquiry |
NUP93-3627HCL | Recombinant Human NUP93 293 Cell Lysate | +Inquiry |
C21orf56-8100HCL | Recombinant Human C21orf56 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket