Recombinant Full Length Synechococcus Sp. Apolipoprotein N-Acyltransferase(Lnt) Protein, His-Tagged
Cat.No. : | RFL32578SF |
Product Overview : | Recombinant Full Length Synechococcus sp. Apolipoprotein N-acyltransferase(lnt) Protein (Q7U5S4) (1-465aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Synechococcus sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-465) |
Form : | Lyophilized powder |
AA Sequence : | MGDLRSQPLLRAVLGGLLAGLAPGVAGPLSMLPALALLWSLVERPRDAALWGLFGVLLSH RWLLGLHPLTWMGLPAWLSLPVAVAIWLSCGVAAALLLLLWSLLARLCRRRDGTWRFGAV LLLALVWGAAELLLEGSPLFWIGVGGSVLPLDRPLAGLGRWLGSGGLATLQLLWGWGLWQ LWRRRGRRCAWWLISLLLAHAMGALSLSPPPALAALRLGAWQPAIPTREKFSPERQRRFQ SALSSALQQAQSLKVEALVAPEGTLPFRWQADEDPLPVPLISGGFRWVRGQQRSSVLLAR PDRAGVEPLVDKHRLVPLGEWLPPLPAGLTRGLSAVGGLQPGDASRFVNVWPSPFAVAIC YEISDGRALAKATAQGAEWLLTIANLDPYPQLLQRQFLALAQLRAIETGRDVLSVANTGP TALVSADGTVQRLLEPQTDAVAAAELQRRQQLTGYSRLVWAWSSR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lnt |
Synonyms | lnt; SYNW1623; Apolipoprotein N-acyltransferase; ALP N-acyltransferase |
UniProt ID | Q7U5S4 |
◆ Recombinant Proteins | ||
RFL11845SF | Recombinant Full Length Saccharomyces Cerevisiae Vacuolar Membrane Protein Scrg_03194 (Scrg_03194) Protein, His-Tagged | +Inquiry |
NCF2-3920R | Recombinant Rat NCF2 Protein | +Inquiry |
IMMP2L-4529M | Recombinant Mouse IMMP2L Protein, His (Fc)-Avi-tagged | +Inquiry |
PROX1A-8978Z | Recombinant Zebrafish PROX1A | +Inquiry |
EMP2-1291R | Recombinant Rhesus Macaque EMP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
IGHA2-615H | Native Human Immunoglobulin Heavy Constant Alpha 2 (A2m marker) | +Inquiry |
IgM-338H | Native Horse IgM | +Inquiry |
GOT1-01H | Active Native Human GOT1 Protein | +Inquiry |
CA72-4-160H | Native Human Cancer Antigen 72-4 | +Inquiry |
Egf-634M | Active Native Mouse Egf | +Inquiry |
◆ Cell & Tissue Lysates | ||
Lung-110M | Mouse Lung Tissue Lysate (14 Days Old) | +Inquiry |
KRT19-4875HCL | Recombinant Human KRT19 293 Cell Lysate | +Inquiry |
HA-2367HCL | Recombinant H1N1 HA cell lysate | +Inquiry |
EVL-6516HCL | Recombinant Human EVL 293 Cell Lysate | +Inquiry |
MS4A6A-4122HCL | Recombinant Human MS4A6A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All lnt Products
Required fields are marked with *
My Review for All lnt Products
Required fields are marked with *
0
Inquiry Basket